PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G073200.1
Common NameB456_010G073200, LOC105773637
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 606aa    MW: 64793.8 Da    PI: 7.2751
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G073200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.92.3e-14124163242
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                         ++k+CnCk+s+Clk+YCeCfa+g++C+  C+C +C N+ e+
  Gorai.010G073200.1 124 KQKQCNCKHSRCLKLYCECFASGVYCDG-CNCVNCYNNVEN 163
                         89**************************.********9875 PP

2TCR50.93.2e-16208247140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Gorai.010G073200.1 208 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 247
                         589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.2E-16123163IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.882124248IPR005172CRC domain
PfamPF036383.8E-11125160IPR005172CRC domain
SMARTSM011148.4E-20208249IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12211246IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MGEGEGGEFP PKKVQSDTAG LPAKKLARQL DFTAGFGGGS SGGVVLPEHP QSTQEMAVAS  60
SSAVAAAVTQ QQQQQQIKPQ MVATSPVAAA QPPPLTTASS RVIKPESPKV KPRPTELKDG  120
TPKKQKQCNC KHSRCLKLYC ECFASGVYCD GCNCVNCYNN VENEAARRDA IEATLERNPN  180
AFRPKIASSP HGVRDSREEA GEVLVLGKHN KGCHCKKSGC LKKYCECFQA NILCSENCKC  240
MDCKNFEGSE ERQALFHGDH ANNMAYIQQA ANAAITGAVG SSGFASIPVS KKRKGQELFF  300
GSTAKDPSVL RLGHFPQATH IRTSAPSPSM PVSCATTTAA VGTSKFTYRS LLADIIQKQD  360
LKELCSVLVV LSGEAAKTLA DQRSLTEKQA EDQTETSLVS STQDTLQSQK DFDAEKTVAD  420
DCSSANQADK VVPEDSSSDG ADTPKESPMS PGTLALMCDE QDTMFMKAPS NGLTEHGCST  480
SSQLPYGQGM TEIYAEQERI VLTKFRDCLN RLITFGEIKE TQCSSLARIE IGSQRSLGNG  540
TEVVRTESGN RQGSFTNGVP KNASPPPIKT SQTAAVVITT SNNDLQRPPS LPENGDAKLK  600
NEKQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-321162572132Protein lin-54 homolog
5fd3_B2e-321162572132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012451133.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X2
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0D2UAJ10.0A0A0D2UAJ1_GOSRA; Uncharacterized protein
STRINGGorai.010G073200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]