PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G045600.1
Common NameB456_010G045600, LOC105771530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 328aa    MW: 36826.5 Da    PI: 6.809
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G045600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.63.2e-14256298547
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                         +r++r++kNRe+A rsR+RK+a++ +Le +v++L++ N+ Lk 
  Gorai.010G045600.1 256 RRQKRMIKNRESAARSRARKQAYTNQLELEVDQLKKMNSWLKR 298
                         69************************************98884 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-10252311IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.117254299IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.63E-10256301No hitNo description
PfamPF001702.9E-12256298IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.3E-13256300No hitNo description
CDDcd147075.15E-25256301No hitNo description
PROSITE patternPS000360259274IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGDRFMMSPN RSEGQHFPPL ASQISSLYNL TFDEVQSQLG KIGKPLNDMN LDELLRSLIA  60
VEEGGLVQNP SSFSSSSSSA ASFFLGNINL NGTLSKKTVD EVWKEIVNNG GGNVNAMDNR  120
FVQHQLTLGE TTLEDFLVRA GVINGGIQDG VIHPQQFMAI DPMAVVSQQA DWLQFQMAAV  180
QQQHHHHQQQ QMTMMDSNFN VPESVYENQV VDVGYHENQL AITMPMPAMS ATSSDSQPTA  240
ARKHRYSDVM EKTIERRQKR MIKNRESAAR SRARKQAYTN QLELEVDQLK KMNSWLKRQK  300
EVEMVLSANT NDTVPKYQLR RTSSASF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448434.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBLA0A0D2U6660.0A0A0D2U666_G
STRINGPOPTR_0002s09140.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17216911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.14e-54ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]