PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G433200.1
Common NameB456_009G433200, LOC105768356
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 343aa    MW: 38353.3 Da    PI: 8.9883
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G433200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.1e-52141391128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF Ptdeel+v+yL++kv+g++++l ++i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk 
  Gorai.009G433200.1  14 LPPGFRFYPTDEELLVQYLCRKVAGHHFSL-QIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKV 103
                         79***************************9.89***************7777799************************************ PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Gorai.009G433200.1 104 ITT-DGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                         *99.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-669163IPR003441NAC domain
PROSITE profilePS5100560.37714162IPR003441NAC domain
PfamPF023653.3E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MVVPETDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGHH FSLQIIAEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITTDGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLL ETSRKSGSSK LDDWVLCRIY KKNSSAQKSL PCVSSKEHSN  180
NGSTSSSSSQ LDDMLEPFPE LDNRYFALPR MNSLKTLQND DKTGFHNLGS GNLDWASLAG  240
LNSVPELVPS GQTQTQGIQS YVNNDLCIPT MPPTLTQMDM SMSKAGNSVE EEVQSGLRTQ  300
RINNSGFFQQ NSSGLMTQNF SNSIDPYGFR YLTQSGGFVF KQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-11011687174NAC domain-containing protein 19
3swm_B1e-11011687174NAC domain-containing protein 19
3swm_C1e-11011687174NAC domain-containing protein 19
3swm_D1e-11011687174NAC domain-containing protein 19
3swp_A1e-11011687174NAC domain-containing protein 19
3swp_B1e-11011687174NAC domain-containing protein 19
3swp_C1e-11011687174NAC domain-containing protein 19
3swp_D1e-11011687174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.23200.0flower| flowering
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in guard cells of the epidermis. {ECO:0000269|PubMed:25005917}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443701.10.0PREDICTED: NAC domain-containing protein 72
SwissprotA0A3Q7HH641e-152JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A0D2U4470.0A0A0D2U447_GOSRA; Uncharacterized protein
STRINGGorai.009G433200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-133NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  4. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]