PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G433100.1
Common NameB456_009G433100, LOC105768355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 345aa    MW: 38484.1 Da    PI: 7.3434
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G433100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.72.2e-53151421128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+
  Gorai.009G433100.1  15 LPPGFRFHPTDEELVVHYLKKKASSAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDKP 104
                         79****************************.88***************988899************************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         vl++ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Gorai.009G433100.1 105 VLTSgGTQKVGVKKALVFYGGKPPKGIKTSWIMHEYRL 142
                         **9977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-657176IPR003441NAC domain
PROSITE profilePS5100561.78115176IPR003441NAC domain
PfamPF023656.3E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MESTDSSIGS QQPNLPPGFR FHPTDEELVV HYLKKKASSA PLPVAIIAEV DLYKFDPWEL  60
PAKATFGEQE WYFFSPRDRK YPNGVRPNRA ATSGYWKATG TDKPVLTSGG TQKVGVKKAL  120
VFYGGKPPKG IKTSWIMHEY RLADNKNNNK PPGYDFSNKK NSLRLDDWVL CRIYKKNNTH  180
RPLDQDKDDS IDDMLGSIQP SISIGNQHNN PKFQFASKGT ATSFGTLLEN HEHSLFDGMM  240
GNNSDEGINN GSMSQSMVNP LKRNLPSLFW TDETSIEPQA NKKFHGDSND GSMEKMDGNG  300
SVTTLLSQLP ESPSLQQQQE TMMGSMGDGI YRPPFQLPGL HWYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-741417814170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout anthers from stages 8 to 12. Later confined to distal region of anthers from stage 13. {ECO:0000269|PubMed:16055634}.
UniprotTISSUE SPECIFICITY: Stamen specific, in anthers from stage 8 (PubMed:15100403, PubMed:16055634). Expressed in the outer integument, but seems not expressed in the embryo at the torpedo stage (PubMed:18849494). {ECO:0000269|PubMed:15100403, ECO:0000269|PubMed:16055634, ECO:0000269|PubMed:18849494}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472010.0KC847201.1 Gossypium hirsutum NAC domain protein NAC24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313855.10.0NAC transcription factor 56-like
RefseqXP_012443700.10.0PREDICTED: NAC transcription factor 25
SwissprotQ9LD441e-125NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A0D2V1M80.0A0A0D2V1M8_GOSRA; Uncharacterized protein
TrEMBLW6J8Q00.0W6J8Q0_GOSHI; NAC domain protein NAC24
STRINGGorai.009G433100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-121NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]