PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G399900.1
Common NameB456_009G399900, LOC105766634
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 258aa    MW: 29221.6 Da    PI: 6.7213
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G399900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1332.1e-4141381127
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                         ++pGfrF Pt+eelv++yL++k+e ++      +++vi+ v+iy+++PwdLp+     ++++ ++w+fF++ ++++a+g r++r t++gyW
  Gorai.009G399900.1   4 MAPGFRFYPTEEELVSFYLHHKLEMERedlnRLMDRVIPIVNIYEFNPWDLPQfsayLCHKDPEQWFFFIPWQESEARGGRPKRLTTTGYW 94 
                         579********************99995653223347***************556653445667*************************** PP

                 NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                         katg+   v+s++++ +g+k+t+vfy+grap+g +t+W m+ey+
  Gorai.009G399900.1  95 KATGSPGFVYSSGNRPIGVKRTMVFYNGRAPNGIRTEWKMNEYK 138
                         *******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.2E-443165IPR003441NAC domain
PROSITE profilePS5100546.2434165IPR003441NAC domain
PfamPF023653.8E-206138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEDMAPGFRF YPTEEELVSF YLHHKLEMER EDLNRLMDRV IPIVNIYEFN PWDLPQFSAY  60
LCHKDPEQWF FFIPWQESEA RGGRPKRLTT TGYWKATGSP GFVYSSGNRP IGVKRTMVFY  120
NGRAPNGIRT EWKMNEYKAI EQGASSISAT PTLRHEFSLC RVYKKSKCLR SFDRRPPAGG  180
VQIIKPNAAA HQGEATAGEA ASGYHKSHQM AGSPESSSSE DHGNPSQTGA SNDSSATVFN  240
YDELFWNLDG FWESQIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-32416517165NO APICAL MERISTEM PROTEIN
1ut4_B6e-32416517165NO APICAL MERISTEM PROTEIN
1ut7_A6e-32416517165NO APICAL MERISTEM PROTEIN
1ut7_B6e-32416517165NO APICAL MERISTEM PROTEIN
4dul_A6e-32416517165NAC domain-containing protein 19
4dul_B6e-32416517165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441617.10.0PREDICTED: NAC domain-containing protein 90-like isoform X1
SwissprotQ9FMR32e-66NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A0D2QVT30.0A0A0D2QVT3_GOSRA; Uncharacterized protein
STRINGGorai.009G399900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101591034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.16e-69NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]