PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G398700.4
Common NameB456_009G398700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TCP
Protein Properties Length: 306aa    MW: 34416.4 Da    PI: 8.8132
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G398700.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP645.6e-204196358
                 TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpa 58
                        ++++ + ++h kv+gRdRR+R++++c   +F L++e G+ ++++ti+WLlqq  p 
  Gorai.009G398700.4 41 KRRRYKGDRHIKVDGRDRRIRIPLTCCSGLFRLTREMGHRTNGETIQWLLQQTRPD 96
                        4566688*********************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136915.58146100IPR017887Transcription factor TCP subgroup
PfamPF036344.6E-174695IPR005333Transcription factor, TCP
SuperFamilySSF563171.03E-33121299IPR003010Carbon-nitrogen hydrolase
Gene3DG3DSA:3.60.110.107.2E-35121300IPR003010Carbon-nitrogen hydrolase
PROSITE profilePS5026324.761122305IPR003010Carbon-nitrogen hydrolase
PfamPF007951.2E-28123299IPR003010Carbon-nitrogen hydrolase
PROSITE patternPS009200154169IPR000132Nitrilase/cyanide hydratase, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006807Biological Processnitrogen compound metabolic process
GO:0016810Molecular Functionhydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MDSQTQSVDQ QQQEEENEQR PFLPENAEEE GGPTSLQPSK KRRRYKGDRH IKVDGRDRRI  60
RIPLTCCSGL FRLTREMGHR TNGETIQWLL QQTRPDLVPP DPVTHPTLLF ASAPAYMEKG  120
RVRATVVQAS TVFFDTPATL DKAERLIAGS AAYGSQLVVF PEAFVGGYPR GFPFESPNED  180
NQELPKYHAS AIEVPGPEVD RLAKISCRYK VHLVMGVVEK DGFYLFSTIL FFDPVGRYLG  240
KHRKLMRSAS ECVVWCSGEK SSLPLYRTAI GKVGGLLYLD NRIPSLRTEL YAKGRIIVCC  300
QLRNP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wuy_A5e-2012130215196Nitrilase
3wuy_B5e-2012130215196Nitrilase
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in leaves and cotyledons, lower expression in stems and roots. {ECO:0000269|PubMed:16786295}.
Functional Description ? help Back to Top
Source Description
UniProtHighly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN). Not associated with auxin production but may be involved in cyanide detoxification (By similarity). {ECO:0000250}.
UniProtInvolved in the cyanide detoxification pathway. Has nitrilase and nitrile-hydratase activity in the ratio 3.3:1, producing both asparagine and aspartic acid from beta-cyano-L-alanine (Ala(CN)). Can also use 3-phenylpropionitrile as substrate, but not indole-3-acetonitrile. {ECO:0000269|PubMed:16786295}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441605.10.0PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B-like isoform X2
SwissprotQ3LRV48e-73NRL4B_LUPAN; Bifunctional nitrilase/nitrile hydratase NIT4B
SwissprotQ6H8491e-72NRL4_ORYSJ; Bifunctional nitrilase/nitrile hydratase NIT4
TrEMBLA0A0D2U2C70.0A0A0D2U2C7_GOSRA; Uncharacterized protein
STRINGGorai.009G398700.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.12e-19TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Piotrowski M,Volmer JJ
    Cyanide metabolism in higher plants: cyanoalanine hydratase is a NIT4 homolog.
    Plant Mol. Biol., 2006. 61(1-2): p. 111-22
    [PMID:16786295]
  3. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  4. Shearer AG,Altman T,Rhee CD
    Finding sequences for over 270 orphan enzymes.
    PLoS ONE, 2014. 9(5): p. e97250
    [PMID:24826896]