PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G398700.2
Common NameB456_009G398700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TCP
Protein Properties Length: 338aa    MW: 37210.9 Da    PI: 4.8406
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G398700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP63.76.7e-204196358
                 TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpa 58
                        ++++ + ++h kv+gRdRR+R++++c   +F L++e G+ ++++ti+WLlqq  p 
  Gorai.009G398700.2 41 KRRRYKGDRHIKVDGRDRRIRIPLTCCSGLFRLTREMGHRTNGETIQWLLQQTRPD 96
                        4566688*********************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136915.58146100IPR017887Transcription factor TCP subgroup
PfamPF036345.4E-174695IPR005333Transcription factor, TCP
SuperFamilySSF563172.62E-11121180IPR003010Carbon-nitrogen hydrolase
Gene3DG3DSA:3.60.110.101.2E-11121184IPR003010Carbon-nitrogen hydrolase
PfamPF007953.7E-10123196IPR003010Carbon-nitrogen hydrolase
PROSITE patternPS009200154169IPR000132Nitrilase/cyanide hydratase, conserved site
SuperFamilySSF563176.28E-17194304IPR003010Carbon-nitrogen hydrolase
Gene3DG3DSA:3.60.110.101.9E-18196300IPR003010Carbon-nitrogen hydrolase
PfamPF007958.0E-12205297IPR003010Carbon-nitrogen hydrolase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006807Biological Processnitrogen compound metabolic process
GO:0016810Molecular Functionhydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MDSQTQSVDQ QQQEEENEQR PFLPENAEEE GGPTSLQPSK KRRRYKGDRH IKVDGRDRRI  60
RIPLTCCSGL FRLTREMGHR TNGETIQWLL QQTRPDLVPP DPVTHPTLLF ASAPAYMEKG  120
RVRATVVQAS TVFFDTPATL DKAERLIAGS AAYGSQLVVF PEAFVGGYPR GFPFESPNED  180
NQELPKYHAS AIEVPGIQMY CAPTADAREE WRASMIHIAI EGRCFVLSAN QFCRRKDYSL  240
PLKCIDGDSN SDLLDTIVCS GGSVIVSPSG TILAGPNYQG ESLISADLDL EEITRAKLEF  300
GEVGLGMGPD SVGWSANKPN LVLYQTAVKT EAFVDLS*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, cotyledons, leaves and flowers. {ECO:0000269|PubMed:10574458}.
Functional Description ? help Back to Top
Source Description
UniProtHighly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN). Not associated with auxin production but may be involved in cyanide detoxification. {ECO:0000269|PubMed:10574458, ECO:0000269|PubMed:11060302, ECO:0000269|PubMed:11089910}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by abscisic acid or by 1-aminocyclopropane-1-carboxylic acid (ACC). {ECO:0000269|PubMed:10574458}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016738913.10.0PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B-like isoform X2
SwissprotQ429655e-44NRL4A_TOBAC; Bifunctional nitrilase/nitrile hydratase NIT4A
TrEMBLA0A0D2SFY80.0A0A0D2SFY8_GOSRA; Uncharacterized protein
STRINGGorai.009G398700.11e-125(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.12e-19TCP family protein
Publications ? help Back to Top
  1. Dohmoto M,Sano J,Tsunoda H,Yamaguchi K
    Structural analysis of the TNIT4 genes encoding nitrilase-like protein from tobacco.
    DNA Res., 1999. 6(5): p. 313-7
    [PMID:10574458]
  2. Piotrowski M,Schönfelder S,Weiler EW
    The Arabidopsis thaliana isogene NIT4 and its orthologs in tobacco encode beta-cyano-L-alanine hydratase/nitrilase.
    J. Biol. Chem., 2001. 276(4): p. 2616-21
    [PMID:11060302]
  3. Dohmoto M,Tsunoda H,Isaji G,Chiba R,Yamaguchi K
    Genes encoding nitrilase-like proteins from tobacco.
    DNA Res., 2000. 7(5): p. 283-9
    [PMID:11089910]
  4. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]