PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G396900.1
Common NameB456_009G396900, LOC105766599
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 654aa    MW: 71137.3 Da    PI: 6.998
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G396900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-093694061954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Gorai.009G396900.1 369 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 406
                         554459******************************88 PP

2BELL121.14.6e-39230301172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         e+qe+q+kkakL+++l+eV++rY+qy++q+q+v ssFe++ag+gsak Yt+lAlk+iS++FrcLkdai++qi
  Gorai.009G396900.1 230 EKQEIQMKKAKLINMLDEVEQRYRQYHHQMQIVTSSFEQAAGIGSAKTYTALALKTISKQFRCLKDAITDQI 301
                         689********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-63148299IPR006563POX domain
PfamPF075262.5E-49155298IPR006563POX domain
PROSITE profilePS5007112.195347410IPR001356Homeobox domain
SMARTSM003895.3E-9350414IPR001356Homeobox domain
CDDcd000867.51E-12350411No hitNo description
SuperFamilySSF466898.55E-17351416IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-29353416IPR009057Homeodomain-like
PfamPF059202.7E-18367406IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MATYFHGNPE IQASTDGLQT LVLMNPAYVQ YSDTPPPPQA SNLLFFNPNS LSPPQTQQLV  60
GIPLPATSAA NQGPTSHDIS PLHGLVQRVH YNMYNPIDPS GSARETPRAQ QGLSLTLSSQ  120
QQPGYGSQAQ AVSGGSASSG SGVHNRVSGV QSVFLSSKYL KAAQELLDEV VNVNTTGITK  180
SELLAKKGGG GNNHSNSSSK AMGESSVVAG DGSGGGEAGE KHVAELTTAE KQEIQMKKAK  240
LINMLDEVEQ RYRQYHHQMQ IVTSSFEQAA GIGSAKTYTA LALKTISKQF RCLKDAITDQ  300
IRAANKSLGE EEDGVGEAAK IEGSRLKFVD HHLRQQRALQ QLGMIQHNAW RPQRGLPERS  360
VSVLRAWLFE HFLHPYPKDS DKHMLAKQTG LTRSQVSNWF INARVRLWKP MVEEMYLEET  420
KEQEQNGTSD DKTSKTENHE DSASKSTAPS CQNPGENQKV SSMSISTAST SPLAGNAHQQ  480
SRFSLIGSSE LEGITQGSPK KPRSNELLQS PTSVQSMNMD MNQSEASNEV SMKFRKDGYS  540
FMGTNTDFMG GFGQYPIGEI GRFDAEQFAP RFPGNGVSLT LGLPHCENLS LSGAHQNLIP  600
NQTMQMGRRL DIDEPNEFGA INPPTPHSSA AYESINLHNR KRFVAQLLPD FVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16356414563Homeobox protein Meis2
3k2a_B4e-16356414563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.7140.0seedling
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441570.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012441571.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012441572.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0D2TZD50.0A0A0D2TZD5_GOSRA; Uncharacterized protein
STRINGGorai.009G396900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-164BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]