PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G394400.1
Common NameB456_009G394400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 249aa    MW: 27008.4 Da    PI: 9.0652
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G394400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA47.75e-15891202658
           CBFB_NFYA  26 eekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          e+k+ +k+rkpylh SRh hA+rRpRg+gGrF
  Gorai.009G394400.1  89 LETKV-TKARKPYLHYSRHLHAVRRPRGNGGRF 120
                         57899.9*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5115217.154123IPR001289Nuclear transcription factor Y subunit A
SMARTSM005211.1E-980123IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.3E-1289120IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
INQKNHTRIN SQESDCKDSG DEPMLKAVIP RQQSLQSEHG LGQPMVCAKY PYLMDQGYGV  60
FPTFGPQISG RVMLPLNLAT EDGPIYAALE TKVTKARKPY LHYSRHLHAV RRPRGNGGRF  120
LNTKSSNTGK DGMEMMKANE GQLSRLTGSQ ISQVLQSDSG TINSYKEPNG GSSTFSGSEV  180
SSSMYSRGDL SKGIGGDSVS HFPCNNQRDQ VSVARQIILG SSHLKLFFTT LNAIALEGVV  240
EDAQLNLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016700003.11e-134PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_016702219.11e-134PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLA0A0D2SFL40.0A0A0D2SFL4_GOSRA; Uncharacterized protein (Fragment)
STRINGGorai.009G394400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30082767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.32e-31nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]