PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G333800.1
Common NameB456_009G333800, LOC105765910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 394aa    MW: 45024.2 Da    PI: 6.7383
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G333800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.43.5e-2784165286
            trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         W ++e++ Li +rrem+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k+++++     s +++y++++e
  Gorai.009G333800.1  84 WVQDETRSLIGFRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGS---GSAKMSYYKEIE 165
                         ********************************************************************84...556899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-474145IPR009057Homeodomain-like
PROSITE profilePS500908.29376140IPR017877Myb-like domain
SMARTSM007170.007780142IPR001005SANT/Myb domain
CDDcd122034.66E-2982147No hitNo description
PfamPF138376.0E-2183167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MYLSEKPRPI DLYKEEGPAA APRDMIIEVT SNGDLPPHHH HHHPPPPHHH HQHQQQQQQQ  60
QMILGESSGE DPEVKAPKKR AETWVQDETR SLIGFRREMD GLFNTSKSNK HLWEQISAKM  120
REKGFDRSPT MCTDKWRNLL KEFKKAKHQD RGSGSAKMSY YKEIEEILRE RTKNSYKSPT  180
PPPKPDSFMH FADKGFEDAG ISFGPVEASG RPTLNLERRL DHDGHPLAIT AADAVAASGV  240
PPWNWRETPG NGGDCQSYGG RVITVKYGDY TRRIGIDGTA DAIREAIKSA FGLRTKRSFW  300
LEDEDNIVRS FDREMPLGNY TLHLDEGLAI KVCLYDESDH IPVHTEDKIF YTEDDYREYL  360
ARRGYTGLRD IDGYRSIDNM DDLRPNAIYR GVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A6e-5278163186DNA binding protein GT-1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5272091e-98HQ527209.1 Gossypium herbaceum clone NBRI_D_EYT27PB02D0J5N simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440641.10.0PREDICTED: trihelix transcription factor GT-1
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0D2UXS50.0A0A0D2UXS5_GOSRA; Uncharacterized protein
STRINGGorai.009G333800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein
Publications ? help Back to Top
  1. Le Gourrierec J,Li YF,Zhou DX
    Transcriptional activation by Arabidopsis GT-1 may be through interaction with TFIIA-TBP-TATA complex.
    Plant J., 1999. 18(6): p. 663-8
    [PMID:10417717]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]