PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G309300.2
Common NameB456_009G309300, LOC105770842
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 451aa    MW: 50281.3 Da    PI: 5.9334
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G309300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.51.3e-53331601128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrFhPtdeelv++yLk+kv++k+ ++ ++i+evdiyk+ePw+L   +k+k++++ewyfFs  dkky +g r nrat +gyWkatgkd
  Gorai.009G309300.2  33 LAPGFRFHPTDEELVSYYLKRKVTNKPARF-DAIAEVDIYKHEPWNLSdkSKLKTRDQEWYFFSLLDKKYGNGGRMNRATGQGYWKATGKD 122
                         579************************999.99**************85348889999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +ev + +++l+g+kktLvf++g+ap+g +t+Wvmheyrl
  Gorai.009G309300.2 123 REVRH-NSQLIGMKKTLVFHSGKAPDGLRTNWVMHEYRL 160
                         *****.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-6029182IPR003441NAC domain
PROSITE profilePS5100556.99233182IPR003441NAC domain
PfamPF023651.0E-2735160IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MGRETSLVAD PGPTAVATAT AKAAKTGSSA TALAPGFRFH PTDEELVSYY LKRKVTNKPA  60
RFDAIAEVDI YKHEPWNLSD KSKLKTRDQE WYFFSLLDKK YGNGGRMNRA TGQGYWKATG  120
KDREVRHNSQ LIGMKKTLVF HSGKAPDGLR TNWVMHEYRL IEEELERIGA LQGYVLCRVI  180
HKNNIGPPNG NRYAPFIEAE WDDGSAALVP GLDTEDDIAA GNESIARNDV AATENAATES  240
NGVLRISSEQ DIEHPDEDAP PSDDVPRESS NERTDDCTLL PPFKIERSDD CPPLCMPNRE  300
APLSLFGHKR RRHNDFGPNH ANVTENSTRM TQDRWSSTTT TTTTTTPPPS SATTMAVSAL  360
LEFSLMESME PKENHHVPPT PKYNATTNLN SMVPPSCMKL INYLQNEIHK TSIERETLKL  420
EMMSAQTMID ILQSKIDFLS KENEDLKKSN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-473218419170NAC domain-containing protein 19
3swm_B5e-473218419170NAC domain-containing protein 19
3swm_C5e-473218419170NAC domain-containing protein 19
3swm_D5e-473218419170NAC domain-containing protein 19
3swp_A5e-473218419170NAC domain-containing protein 19
3swp_B5e-473218419170NAC domain-containing protein 19
3swp_C5e-473218419170NAC domain-containing protein 19
3swp_D5e-473218419170NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in floral organs, and, at low levels, in other organs. {ECO:0000269|PubMed:25578968}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472461e-168KC847246.1 Gossypium hirsutum NAC domain protein NAC69 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447653.10.0PREDICTED: NAC domain-containing protein 45-like isoform X2
SwissprotQ9SQX91e-147NAC50_ARATH; NAC domain containing protein 50
TrEMBLA0A0D2UWP00.0A0A0D2UWP0_GOSRA; Uncharacterized protein
STRINGGorai.009G309300.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-136NAC domain containing protein 50
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]