PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G309200.1
Common NameB456_009G309200, LOC105770843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 284aa    MW: 31579.9 Da    PI: 4.6455
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G309200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.39.3e-10120166450
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                          k++rr  +NR AA rsR+RKk +++ Le k+  Le+e ++L   l+
  Gorai.009G309200.1 120 AKKQRRQLRNRDAAVRSRERKKVYVKDLEMKSRYLEGECRRLSRVLQ 166
                         69************************************999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-6114181IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.0E-12115179No hitNo description
PROSITE profilePS502179.852119176IPR004827Basic-leucine zipper domain
PfamPF001708.3E-10120176IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-11121179No hitNo description
CDDcd147041.75E-17122173No hitNo description
PROSITE patternPS000360124139IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEEINWDTLL LEVDLPDFGD ILDNEPEPVT EPPPQPCSTQ NSDEEPAVSS WIGEIEKVLM  60
EDDNFDHRVE TQPVSDDDFL ADLLVDSPPS SGGDVAGVDG ADLHKQSQTH TDVDKDDPIA  120
KKQRRQLRNR DAAVRSRERK KVYVKDLEMK SRYLEGECRR LSRVLQCFIA ENQALRLTLH  180
KGCAFDASST KQESAVLLLE SLLLGSLLWF LGIMCLFTLP ILPKSVLEAV PMANEETQGP  240
ERVAPRGAGS NRVGPSFVKS RRCKASRGKM KEISCFMGIL VPF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447655.10.0PREDICTED: bZIP transcription factor 60-like
TrEMBLA0A0D2SBE60.0A0A0D2SBE6_G
STRINGPOPTR_0005s27930.14e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.13e-29basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]