PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G309000.1
Common NameB456_009G309000, LOC105770837
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 592aa    MW: 66330.2 Da    PI: 4.4937
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G309000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.21.1e-5191351128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrFhPtdeelv +yLk+k+ +++   +++i+ +diy++ePwdLp k k+k+++ ewyfFs  dkky +g+r+nrat++gyWk+tgkd
  Gorai.009G309000.1   9 LAPGFRFHPTDEELVRYYLKRKILNRP--SFDAISVIDIYRSEPWDLPdKsKLKSRDLEWYFFSALDKKYGNGSRTNRATERGYWKTTGKD 97 
                         579**********************99..3478**************95347777888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++   ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  Gorai.009G309000.1  98 RAIRF-RERVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 135
                         ****9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.76E-607158IPR003441NAC domain
PROSITE profilePS5100557.739158IPR003441NAC domain
PfamPF023656.5E-2811135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MGRDSATSLA PGFRFHPTDE ELVRYYLKRK ILNRPSFDAI SVIDIYRSEP WDLPDKSKLK  60
SRDLEWYFFS ALDKKYGNGS RTNRATERGY WKTTGKDRAI RFRERVVGMK KTLVYHKGRA  120
PRGERTNWVM HEYRLTDETL EKGGIQQDAF VLCRVFQKSG SGPKNGEQYG APFIEEEWED  180
DEAVFVPGQQ DASAHEEAAN EDAFVEVNDI DQNLDIGNPS ESNILPLNGY CGESSNHVEH  240
SREFSEDDQN LQNSMHENAF LPSSFYYGES SNCGEHSIEF KEDYQKPIRM HATEGDSKPH  300
HELVVADSPE QNLIATNGKP VKDEYVLEPI ENITSANYVL GNPYLDHTSY LPTNDELFLE  360
ANDFSNPIYP ESELFDINEY LLFYDADDQS LAFDCDEIVG SEIPVSDQEP LTETHTNEGT  420
EQDLNASEHV EEHGNSDASS SKQELEATEF DLGTKYPFMK RASHMLGSLP APPAFASEFP  480
PKDAAIKLNS ASHASSSVHV MAGMIRITDT TSSGNRLDWS YGKNGNLNIV LSFSLPQGDI  540
DSSSFLPMAS LLSGKTGPVS ARGWFFLMLF SVLIISASVK IGTCFCTRYG L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-45816416171NO APICAL MERISTEM PROTEIN
1ut4_B6e-45816416171NO APICAL MERISTEM PROTEIN
1ut7_A6e-45816416171NO APICAL MERISTEM PROTEIN
1ut7_B6e-45816416171NO APICAL MERISTEM PROTEIN
3swm_A7e-45816419174NAC domain-containing protein 19
3swm_B7e-45816419174NAC domain-containing protein 19
3swm_C7e-45816419174NAC domain-containing protein 19
3swm_D7e-45816419174NAC domain-containing protein 19
3swp_A7e-45816419174NAC domain-containing protein 19
3swp_B7e-45816419174NAC domain-containing protein 19
3swp_C7e-45816419174NAC domain-containing protein 19
3swp_D7e-45816419174NAC domain-containing protein 19
4dul_A6e-45816416171NAC domain-containing protein 19
4dul_B6e-45816416171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root meristem (Ref.1). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9141440.0JQ914144.1 Gossypium hirsutum NAC domain protein 13 (NAC13) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447647.10.0PREDICTED: NAC domain-containing protein 53
SwissprotQ84K001e-170NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A0D2SBD80.0A0A0D2SBD8_GOSRA; Uncharacterized protein
STRINGGorai.009G309000.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-159NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  5. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  6. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  7. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]