PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G301400.2
Common NameB456_009G301400, LOC105770652
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 318aa    MW: 35362.8 Da    PI: 6.8162
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G301400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.83.7e-16247296555
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                         +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+ + +el k+
  Gorai.009G301400.2 247 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLR-KQKELDKM 296
                         79****************************************.55666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.2E-15238290No hitNo description
SMARTSM003385.2E-13243315IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.76245290IPR004827Basic-leucine zipper domain
CDDcd147071.55E-24247301No hitNo description
PfamPF001701.6E-13247291IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-11247292No hitNo description
PROSITE patternPS000360250265IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGSQGDSGSN GKQLQCQPIT RQNSMYSLTL DEVQNQLGDL GKPLNSMNLD ELLKNVWTLE  60
ANQTLGMETE GTAVTNQTSL QRQASLSLTS ALSKKTVDEV WKDIQQNKID GEKKSRERQP  120
TLGEMTLEDF LVKAGVVTEA STDENAGPPI AGVDLSVAPQ FAQQGQWMQY PQQPQYHHPQ  180
QSIMGVYMPA QPMPQPLAIG TTGVMDVSYP ENQLALPSPL MGTLSDTQAS GRKRGAHEDI  240
VEKTVERRQK RMIKNRESAA RSRARKQAYT NELENKVSRL EEENERLRKQ KELDKMLPSA  300
PPPEPKYQLR RTSSAPF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP9382990.0KP938299.1 Gossypium hirsutum strain KK1543 bZIP transcription factor (bZIP15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447412.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X2
RefseqXP_012447411.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X2
RefseqXP_012447410.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
SwissprotQ9LES31e-106AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0D2QQL20.0A0A0D2QQL2_G
TrEMBLA0A0D2TXI20.0A0A0D2TXI2_G
STRINGPOPTR_0008s01130.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-91ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]