PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G301400.1
Common NameB456_009G301400, LOC105770652
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 323aa    MW: 35893.4 Da    PI: 6.8162
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G301400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.73.8e-16252301555
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                         +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+ + +el k+
  Gorai.009G301400.1 252 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLR-KQKELDKM 301
                         79****************************************.55666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.3E-15243295No hitNo description
SMARTSM003385.2E-13248320IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.76250295IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-11252297No hitNo description
CDDcd147071.17E-24252306No hitNo description
PfamPF001701.7E-13252296IPR004827Basic-leucine zipper domain
PROSITE patternPS000360255270IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGIQTMGSQG DSGSNGKQLQ CQPITRQNSM YSLTLDEVQN QLGDLGKPLN SMNLDELLKN  60
VWTLEANQTL GMETEGTAVT NQTSLQRQAS LSLTSALSKK TVDEVWKDIQ QNKIDGEKKS  120
RERQPTLGEM TLEDFLVKAG VVTEASTDEN AGPPIAGVDL SVAPQFAQQG QWMQYPQQPQ  180
YHHPQQSIMG VYMPAQPMPQ PLAIGTTGVM DVSYPENQLA LPSPLMGTLS DTQASGRKRG  240
AHEDIVEKTV ERRQKRMIKN RESAARSRAR KQAYTNELEN KVSRLEEENE RLRKQKELDK  300
MLPSAPPPEP KYQLRRTSSA PF*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP9382990.0KP938299.1 Gossypium hirsutum strain KK1543 bZIP transcription factor (bZIP15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447410.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
SwissprotQ9LES31e-106AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0D2TXI20.0A0A0D2TXI2_G
STRINGPOPTR_0008s01130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-91ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  3. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]