PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G301200.1
Common NameB456_009G301200, LOC105770648
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 322aa    MW: 35739.2 Da    PI: 7.7431
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G301200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.51.9e-15251299554
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                         +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+k+ +el+k
  Gorai.009G301200.1 251 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLRKR-KELEK 299
                         79****************************************65.55555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.1E-15240299No hitNo description
SMARTSM003382.1E-12247315IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.691249294IPR004827Basic-leucine zipper domain
CDDcd147077.18E-24251305No hitNo description
PfamPF001706.1E-13251296IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.19E-10251296No hitNo description
PROSITE patternPS000360254269IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGIQTMGSQG DSGSNGKQLQ FQQLTQQNSM YSLTLDEVQN QLGDLGKPLS SMNLDELLKN  60
VWTLEANQTF GMDSDGTVLT NQASLQRQAS LSLTGALSKK TVDEVWRDIQ QSKNDGEKKS  120
RERQPTLGEM TLEDFLVKAG VVAEASTDGD VGASIAGVDL SVAPQFAQQG QWMQYPQPQY  180
HHPQQSIMGV YMPPQPMPRP LALGTAAVMD VSYPENQVPL HSPLMGTLSD TQASGRKRGA  240
PEDIVEKNVE RRQKRMIKNR ESAARSRARK QAYTNELENK VSRLEEENER LRKRKELEKL  300
LPSAPPPEPK YQLRRTSSAP F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447401.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_012447402.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_012447403.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_012447404.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES31e-102AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0D2UW500.0A0A0D2UW50_G
STRINGPOPTR_0008s01130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-79ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]