PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G295000.2
Common NameB456_009G295000, LOC105771187
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 224aa    MW: 24322.8 Da    PI: 8.6616
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G295000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.5e-42441431100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+
  Gorai.009G295000.2  44 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSLQ 134
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ael+++++e
  Gorai.009G295000.2 135 AELNAVRAE 143
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81343144IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4244141IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKREAD VSANYQMGRR HMLGPPGTLN TITPCAACKL LRRRCAQECP  60
FSPYFSPHEP QKFASVHKVF GASNVSKMLM EVPESQRADA ANSLVYEANV RLRDPVYGCM  120
GAISALQQQV QSLQAELNAV RAEIIKYKCR EANLVPPSSH VAMLSSGAVS VAAPPPATTQ  180
PPPPPPPPPL PTTTAVTTCS IYTQPNTSTD YTTLSNDNVS YFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448054.11e-165PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T52e-89LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A0D2QQ341e-165A0A0D2QQ34_G
STRINGVIT_13s0067g02380.t011e-121(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.16e-89LOB domain-containing protein 15
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]