PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G293600.1
Common NameB456_009G293600, LOC105770533
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 372aa    MW: 40353.8 Da    PI: 6.4159
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G293600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.41e-10170222557
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +    
  Gorai.009G293600.1 170 KRAKRIIANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTT 222
                         9****************************************999877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-17166230IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622168231IPR004827Basic-leucine zipper domain
PfamPF001702.8E-9170219IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.84E-11170221No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-10170224No hitNo description
CDDcd147036.52E-24171220No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGTPKMQDPP SLDPNPDRPF PSNASSSTTQ TTPSFPNPTS FRGSYHRRAH SEVQFRIPDD  60
LDLVSDPFEG LGSEDDLFCT YVDIEKLGGS SKGSEDGGGA AGSSSGGSGR NPEGEEMSGV  120
SGKGEKNNGG GKGRHRYSNS IDGCSLMESI EAKKAMSPDK LAELWTIDPK RAKRIIANRQ  180
SAARSKERKA RYISELERKV QTLQTEATTL SAQLTLFQRD TTGLTTENTE LKLRLQAMEQ  240
QAQLRDALNE ALKKEVERLK SATGEITTST DTFNLGMHRM PYNQSSFFPP QPEHMQVGTP  300
NIQMPPFHPL RSNMLTPNQS VVTSSNSQAF AGIMQQDPLG RLQGLDISSR SSHLVKSESP  360
SISADESSGT L*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269|PubMed:27896439}.
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447231.10.0PREDICTED: transcription factor RF2b-like
SwissprotO228731e-113BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A0D2SAA30.0A0A0D2SAA3_GOSRA; Uncharacterized protein
STRINGGorai.009G293600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-108bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  4. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  6. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]