PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G260000.1
Common NameB456_009G260000, LOC105769884
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 652aa    MW: 73602.7 Da    PI: 4.5891
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G260000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.91.4e-51211472128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         ppGfrFhPtdeelv +yLk+k+ ++kl+l ++i+e+d+yk++P++Lp +  +k+++++w+fFs+rd+ky++  r+nrat +gyWkatgkd+
  Gorai.009G260000.1  21 PPGFRFHPTDEELVLYYLKRKICRRKLKL-DIIRETDVYKWDPEELPaQsILKSGDRQWFFFSPRDRKYPNAARSNRATGHGYWKATGKDR 110
                         8****************************.99**************96346778999********************************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +v++ ++++vg+kktLvfy+grap ge+tdWvmhey+l
  Gorai.009G260000.1 111 TVTC-NSRTVGVKKTLVFYRGRAPIGERTDWVMHEYTL 147
                         ****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-5915170IPR003441NAC domain
PROSITE profilePS5100554.59720170IPR003441NAC domain
PfamPF023651.8E-2721147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MTVAAKAATT GSCFGEDQVW PPGFRFHPTD EELVLYYLKR KICRRKLKLD IIRETDVYKW  60
DPEELPAQSI LKSGDRQWFF FSPRDRKYPN AARSNRATGH GYWKATGKDR TVTCNSRTVG  120
VKKTLVFYRG RAPIGERTDW VMHEYTLDEE ELKRCQNVKD YYALYKLYKK SGPGPKNGEQ  180
YGAPFKEEEW ADEEYASKAV DVITPVKHPN EAFPDDVEKA KNQIQSPLND IEEFMRQFAA  240
EPALPQPQAH FDNILPRLAG EEEIQSTLLD TSPRDVLLPK PVEVVHDHAS FELSQSPTSR  300
LQLQEAPEDA SVSDQFEQIP QICEEDFLEI DDLTSNVEKP AENGLQFNDW DGLGEFDLYH  360
DAAMFLQDIG PIEQGIVPFS YTENMINQVS YPLEPQLQHQ SNTYHMDQEL QFQLNGTGVD  420
EQLQLQSNAF GNNQQVQSQL NTIGDNQPQL NAFEDGILNQ VGYQFHSSAN NMMDQQLVPN  480
STVDQVDYHL PFQSFGNEME RQLQMDQING SIWINDQSGD VFTPSGSNLG NASSSSGLVY  540
NGNNQDEGDK NGEGASRFST AVWSFVDSIP TTPASASESP SVNRAFERMS SFSRLRMNVR  600
NTNALTVNGG TTARRRSRNK GFFFFSILGA LCAILWFLIG MVRVVRSSIS S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-492114716140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446285.10.0PREDICTED: NAC domain-containing protein 16-like isoform X1
TrEMBLA0A0D2TVM30.0A0A0D2TVM3_GOSRA; Uncharacterized protein
STRINGGorai.009G260000.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-111NAC domain containing protein 17
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]