PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G212600.2
Common NameB456_009G212600, LOC105769230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 424aa    MW: 45159.6 Da    PI: 9.8202
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G212600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.77.9e-16345396556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+  e+ ++ 
  Gorai.009G212600.2 345 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELRKKHAEIMEMQ 396
                         79*****************************************999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-12341402IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.519343394IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.81E-11345394No hitNo description
CDDcd147073.27E-28345399No hitNo description
PfamPF001701.2E-13345396IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.2E-15345394No hitNo description
PROSITE patternPS000360348363IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MGTNMNFGSN PPPSGDGGGN KPPGNNLLTR QPSIYSLTFD EFQSTMGGIG KDFGSMNMDE  60
LLRNIWSAEE IQTMASSGGV LEGNGGLQRQ GSLTLPRTLS QKTVDEVWKD ISKEYSLGKD  120
GIGGGGGTNN MPQRQQTLGE MTLEEFLVRA GVVIEDTQLA GKVNNEGFFG GNNTGFEIGF  180
QQGGKGPNLM GTRIPDGGNQ INIQASNLHP NVNGVRSNQH QLAQQHQHQQ PIFPKQTGVG  240
YGAQIPLQSG GQLGSPGIRS GMHGIGDQGI SNGLIQAGAL QGGGMGMVGL GGAVGVATGS  300
PANQVSSDGI GKSSGDTSSV SPVPYVFNGS MRGRKYSAVE KVAERRQRRM IKNRESAARS  360
RARKQAYTME LEAEVAKLKE ENQELRKKHA EIMEMQKNQV IEMVDMQQGA KKRCLRRTQT  420
GPW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445168.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-137AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A0D2QKJ40.0A0A0D2QKJ4_G
TrEMBLA0A0D2TTD00.0A0A0D2TTD0_G
STRINGPOPTR_0002s12710.11e-172(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-109abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]