PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G192500.1
Common NameB456_009G192500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 216aa    MW: 23669.7 Da    PI: 10.3836
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G192500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.11.2e-15145195353
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                          ++r +r++kNRe+A rsR+RK+a++ eLe kv+ L++eN +L+ + e++ 
  Gorai.009G192500.1 145 NDRRHKRMMKNRESAARSRARKQAYTTELELKVAHLQEENAKLRRQQEKIL 195
                         689*****************************************8776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-12143207IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.346145194IPR004827Basic-leucine zipper domain
PfamPF001702.6E-13146194IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.69E-11147194No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-14147194No hitNo description
CDDcd147071.32E-27147197No hitNo description
PROSITE patternPS000360150165IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MEEVWKDISL ASLSDHPVDS ILSTRTKNPN FPSMILLNFL ATPINKEPPT PRTSVVSSND  60
TSSTEGPAPF VPGTILSLKS GFGSACRCTE TGDPMRPNLE VNARAGVPAA PSFSSYSSGF  120
RGFGSPEAFP SFCTKRAPES NENSNDRRHK RMMKNRESAA RSRARKQAYT TELELKVAHL  180
QEENAKLRRQ QEKILAARDQ VPKKNTLSRT STAPF*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441842.11e-157PREDICTED: protein FD-like, partial
TrEMBLA0A0D2TSJ51e-158A0A0D2TSJ5_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19342772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.12e-42bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]