PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G187500.1
Common NameB456_009G187500, LOC105769932
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Nin-like
Protein Properties Length: 941aa    MW: 104659 Da    PI: 6.6411
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G187500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.51.2e-27601652152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+i+l++l++yFs ++kdAAk+Lgvc+T+LKr+CR++GI+RWP+Rk++++
  Gorai.009G187500.1 601 AEKTITLQVLRQYFSESLKDAAKSLGVCPTTLKRTCRHHGIERWPSRKLQKV 652
                         589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.302591672IPR003035RWP-RK domain
PfamPF020422.3E-24604652IPR003035RWP-RK domain
SuperFamilySSF542775.33E-22827915No hitNo description
PROSITE profilePS5174525.483829912IPR000270PB1 domain
SMARTSM006661.8E-22829912IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.5E-21829909No hitNo description
PfamPF005646.7E-18830911IPR000270PB1 domain
CDDcd064072.34E-39831911No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 941 aa     Download sequence    Send to blast
MEDSILLPGM QLDYMDELLL DGCWLEASPT EGSDFLDPNA FFDPTFEWPT LDSNGGDLGG  60
SLFQGEDPIS FLPGNPHMNE NHSQGAHLSH NLDDVDGVSR NLHGDCMTDA SELSRRWWIG  120
PRANPGPSTS VMQRLIGALN HIKDSAKETD VLVQLWLPVN KGGRRILTTS EQPFSLDPNS  180
QRLASYRNIS AKYQFPAEED SKDMAGLPGR VFLSKVPEWT PDVRFFRSDE YHRVDHAQQH  240
GVRGTFALPV FEQGNRTCLG VIEVVMTTEK IKIKPEMESV CKALEAVNLR SFTASSTRNI  300
QACYSSYQAA LPEIKEVLKR ACETHRLPLA QTWVPCMQLG KEGCPHSTEN YFHCVSTVDD  360
ACYIAKPNIR GFHEVCSEHH LLKGQGVAGR AFMTNQPCFS TDITSFKKTE YPLAHHAKML  420
KLHAAVAIRF RCIHTGKADF VLEFFLPVDC RDPEGQKEML NSLSITLQQV CCSLRVVTNE  480
ELEEDRDMGV SEVIASLDGI PCRKELSEEQ CTYHSEKYSR ENSSWTASLT EVNQSSSTST  540
AMKLRKEKPR ATWDEKISKV KQHKKQISLR GTVEGGDSTI NEISFSSATK RKTGQKRHSK  600
AEKTITLQVL RQYFSESLKD AAKSLGVCPT TLKRTCRHHG IERWPSRKLQ KVGNSLEKLQ  660
HVIDSVQGVS GAFHISSLYP NFSELASPRS SGKSTSSASV LGLNDKPKKT TILPEGGNFV  720
SQAATSNSPS SSCSQSSSSS HSCSSGTHHP SKSNISGNGG LIIGENSGNG ELKRVTNDTE  780
LHTLSQEGLK LFPRSHSPAS VKEQLISDSI QPVVTENNSQ IAQDLDAQTQ KVKVTYGDDK  840
IHFRMQSKWR LKDLLLEITR RFNIDDISGF DLKYLDDDSE WVLLTCDADL EECIDVCRWC  900
EGNTIRLLLQ ASHHHLDRSS VLKETLVSCF LHIALAEEVQ *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446359.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_012446360.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_012446362.10.0PREDICTED: protein NLP4-like isoform X1
TrEMBLA0A0D2S3Y10.0A0A0D2S3Y1_GOSRA; Uncharacterized protein
STRINGGorai.009G187500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]