PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G186000.2
Common NameB456_009G186000, LOC105768811
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 396aa    MW: 43922.5 Da    PI: 6.3744
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G186000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.4e-53211481128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelv++yL+ kv + ++     i+evd++++ePw+Lp  +k +e+ewyfFs rd+ky++g r+nrat +gyWkatgkd+e
  Gorai.009G186000.2  21 LPPGFRFHPTDEELVTFYLASKVFHGSFCG-VEIAEVDLNRCEPWELPDVAKMGEREWYFFSLRDRKYPSGLRTNRATGAGYWKATGKDRE 110
                         79*************************777.45***************8888899************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v+s+ +g+l g+kktLvfykgrap+gekt+Wvmheyrl
  Gorai.009G186000.2 111 VYSAsTGALLGMKKTLVFYKGRAPRGEKTKWVMHEYRL 148
                         **9878889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6315170IPR003441NAC domain
PROSITE profilePS5100559.65721170IPR003441NAC domain
PfamPF023659.0E-2822148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MLAVEEILSE LAEEEVNGHG LPPGFRFHPT DEELVTFYLA SKVFHGSFCG VEIAEVDLNR  60
CEPWELPDVA KMGEREWYFF SLRDRKYPSG LRTNRATGAG YWKATGKDRE VYSASTGALL  120
GMKKTLVFYK GRAPRGEKTK WVMHEYRLDG DFSCRPSCKE EWVICRIFHK TSEKKNALAQ  180
GQSYVLAMSS SSTTFLPPLL ETPTPLLKSE SQTLMQAHNS FLIHRHENDL KSLINPVVSE  240
SQSQSQLFPS NGFQPSFSPT STFATTDKNA VTNTTSSAAM LFKSLLSHQD CLFKEQAAFP  300
KQCKAEADFS YLNLPAANNT LNWMDRIHPS PPCQNPLFFD MDYSVLGFAE GVRGTARGDT  360
NAHDMSTSIA IHTASGQMIL NPPTTTASGE SGPLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-512117217167NO APICAL MERISTEM PROTEIN
1ut4_B1e-512117217167NO APICAL MERISTEM PROTEIN
1ut7_A1e-512117217167NO APICAL MERISTEM PROTEIN
1ut7_B1e-512117217167NO APICAL MERISTEM PROTEIN
3swm_A1e-512117220170NAC domain-containing protein 19
3swm_B1e-512117220170NAC domain-containing protein 19
3swm_C1e-512117220170NAC domain-containing protein 19
3swm_D1e-512117220170NAC domain-containing protein 19
3swp_A1e-512117220170NAC domain-containing protein 19
3swp_B1e-512117220170NAC domain-containing protein 19
3swp_C1e-512117220170NAC domain-containing protein 19
3swp_D1e-512117220170NAC domain-containing protein 19
3ulx_A1e-51121739171Stress-induced transcription factor NAC1
4dul_A1e-512117217167NAC domain-containing protein 19
4dul_B1e-512117217167NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at the globular stage, mostly in the apical part of the embryo. During the triangular stage, confined to the boundary of emerging cotyledons. Later restricted to the center of the apical part of the embryo and to seedling apex, at the boundaries of the cotyledon margins and the boundaries between the SAM and the cotyledons. Localized in a one-cell-wide ring at the boundary between trichomes or lateral roots and epidermis. Accumulates at the boundaries between leaf primordia and the shoot meristem and between floral primordia and the inflorescence meristem. Found in the adaxial axils of secondary inflorescences and pedicels, and in axiallary buds. In flowers, expressed in a ring at the bases of sepals and petals. In carpels, confined to the boundaries between ovule primordia. In ovules, localized in a ring at the boundary between the nucellus and the chalaza. In the mature embryo sac, detected in the two polar nuclei of the central cell. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
UniprotTISSUE SPECIFICITY: In a general manner, present at the boundaries between mersitems and araising primordia. {ECO:0000269|PubMed:12837947}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472050.0KC847205.1 Gossypium hirsutum NAC domain protein NAC28 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313889.10.0protein CUP-SHAPED COTYLEDON 3-like
RefseqXP_012444453.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
RefseqXP_012444454.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ9S8511e-106NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A0D2TMA20.0A0A0D2TMA2_GOSRA; Uncharacterized protein
TrEMBLW6JAN50.0W6JAN5_GOSHI; NAC domain protein NAC28
STRINGGorai.009G186000.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.12e-96NAC family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  3. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  4. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  5. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  6. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]