PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G165800.3
Common NameB456_009G165800, LOC105768678
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family VOZ
Protein Properties Length: 484aa    MW: 53753.2 Da    PI: 5.6248
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G165800.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ435.85.8e-1342084232217
                 VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                         ppsaflgpkcalwdc+rpaq  +w qdycssfha+la+neg+pg+ p+lrp+gi+lkdgllfaalsak+qgk+vgipecegaatakspwna
  Gorai.009G165800.3 208 PPSAFLGPKCALWDCPRPAQALDWSQDYCSSFHAALAMNEGPPGMGPILRPGGIGLKDGLLFAALSAKAQGKDVGIPECEGAATAKSPWNA 298
                         7****************************************************************************************** PP

                 VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalaly 183
                         +elfdls+l+ge+irewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyein++da+aly
  Gorai.009G165800.3 299 PELFDLSVLDGESIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALY 389
                         ******************************************************************************************* PP

                 VOZ 184 rlelklvdekksakgkvskdsladlqkklgrlta 217
                         rlelklvd+kksakgk ++d++adlqk++grlta
  Gorai.009G165800.3 390 RLELKLVDGKKSAKGKSANDTVADLQKQMGRLTA 423
                         ********************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MGKGSRSNCK SASHKLFKDR AKNRVDDLQG MFLDLQFARK ESRSVDVAVL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSSDICRL LQLCEEEDDA TSVLAAPKPE PDDQNLQVGD  120
TAAFQEVYGV NQGQHERGFP LVDHCKDSPS GVRTMPINNL DGATQLEYHQ FDLHQDFEHF  180
YTGFNGTGFS GEDAMLHTSS YLPSICLPPS AFLGPKCALW DCPRPAQALD WSQDYCSSFH  240
AALAMNEGPP GMGPILRPGG IGLKDGLLFA ALSAKAQGKD VGIPECEGAA TAKSPWNAPE  300
LFDLSVLDGE SIREWLFFDK PRRAFESGNR KQRSLPDYSG RGWHESRKQV MNEFGGLKRS  360
YYMDPQPLNH FEWHLYEYEI NKCDACALYR LELKLVDGKK SAKGKSANDT VADLQKQMGR  420
LTAEFPTDNK RYVKGRAKIN AKVTVGNPYS TQNAVAPTSE KFDYGHGLQY DYLIDDLSGY  480
YLT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444212.10.0PREDICTED: transcription factor VOZ1-like isoform X2
RefseqXP_012444213.10.0PREDICTED: transcription factor VOZ1-like isoform X2
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0D2S2H10.0A0A0D2S2H1_GOSRA; Uncharacterized protein
STRINGGorai.009G165800.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  4. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  5. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]