PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G165600.1
Common NameB456_009G165600, LOC105766807
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 278aa    MW: 30908.5 Da    PI: 8.324
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G165600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260106.12.8e-3314107194
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC+++Cv+ap fpa+++++f+ vhk+FG++n++ +l+   ++er++a++sl +eA a+++dPv+G +g++++l+++l++l+
  Gorai.009G165600.1  14 ACAACKHQRRKCESNCVFAPFFPASRAESFREVHKIFGVKNMTGILTPRTPDERKKAVESLEWEALAWTQDPVRGPLGLFRRLEEELQHLN 104
                         7**************************************************************************************9988 PP

              DUF260  92 ael 94 
                           l
  Gorai.009G165600.1 105 DLL 107
                         655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.51713114IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3114108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MSNGEEAAPN TRHACAACKH QRRKCESNCV FAPFFPASRA ESFREVHKIF GVKNMTGILT  60
PRTPDERKKA VESLEWEALA WTQDPVRGPL GLFRRLEEEL QHLNDLLDQL VEPYQQNQIN  120
SAGLNGFNHN SVTGRVIVPN SNINATNIGY GSNPYLGIDV PPIDNYDGVP PISSDGLNEN  180
QLVVNNYFPG YYGIPDRLAV FPESGGVDNV AQTSTPSPTL PAKQETMAQR PQIWGPSRRP  240
LTNNHFPLRN HRRGSQQRYQ YGVLQRPASQ SQGRGLH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441826.10.0PREDICTED: LOB domain-containing protein 6-like
TrEMBLA0A0D2TR610.0A0A0D2TR61_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1960367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-27LOB domain-containing protein 2
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]