PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G149900.2
Common NameB456_009G149900, LOC105771172
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 156aa    MW: 17506.2 Da    PI: 9.27
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G149900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.76.4e-46131121100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+
  Gorai.009G149900.2  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDALQ 103
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++la++++e
  Gorai.009G149900.2 104 TQLAMAQAE 112
                         ****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.30412113IPR004883Lateral organ boundaries, LOB
PfamPF031958.1E-4613110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MKESGRKQGA APPCAACKLL RRRCAQDCVF APYFPADEPQ KFANVHKVFG ASNVNKMLQE  60
LPVHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID ALQTQLAMAQ AEVVHLRQYE  120
STKKREVVAV AVALWRLEWF SRSFSIFWFE KGLYH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5838111e-53JX583811.1 Gossypium hirsutum clone NBRI_GE16953 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448039.11e-113PREDICTED: LOB domain-containing protein 4-like isoform X2
SwissprotQ9SHE98e-73LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0D2S1H31e-113A0A0D2S1H3_G
STRINGPOPTR_0001s11610.11e-78(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-74LOB domain-containing protein 4
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]