PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G143800.7
Common NameB456_009G143800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 180aa    MW: 20048.7 Da    PI: 10.2575
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G143800.7genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.48.8e-322580258
           CBFB_NFYA  2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                        ep+YVNaKQy++Il+RRq Rakle+++kl +k rkpy+heSRh hA++R+RgsgG+F
  Gorai.009G143800.7 25 EPIYVNAKQYHAILRRRQYRAKLEAQNKL-IKVRKPYMHESRHLHAIKRARGSGGQF 80
                        8****************************.*************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.2E-352283IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.2632383IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.4E-262580IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-232648IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068602848IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.3E-235780IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MIHHAHMMAM LPARVPLPLD LKEGEPIYVN AKQYHAILRR RQYRAKLEAQ NKLIKVRKPY  60
MHESRHLHAI KRARGSGGQF LNTKKLQSKS TPTSHGPDMS RSPQLHLSAN ISVTDVHQPE  120
NFKDSGSANS CSDVTSASNS DEIFQQPDFR FYGYPSCHTG EAMPGHAGHI LLSSNSRAN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-212588366NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445239.11e-131PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X2
SwissprotQ93ZH23e-50NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A0D2TJS51e-131A0A0D2TJS5_GOSRA; Uncharacterized protein
TrEMBLA0A0D2ULV81e-130A0A0D2ULV8_GOSRA; Uncharacterized protein
STRINGGorai.009G143800.11e-130(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-52nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]