PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G143800.5
Common NameB456_009G143800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 211aa    MW: 23412.6 Da    PI: 10.157
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G143800.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1011.2e-3156111258
           CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         ep+YVNaKQy++Il+RRq Rakle+++kl +k rkpy+heSRh hA++R+RgsgG+F
  Gorai.009G143800.5  56 EPIYVNAKQYHAILRRRQYRAKLEAQNKL-IKVRKPYMHESRHLHAIKRARGSGGQF 111
                         8****************************.*************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.2E-3553114IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.26354114IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.2E-2656111IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.0E-235779IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068605979IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.0E-2388111IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MSFLLHKVHI PHHYANPYLG SVAATAYGSQ AMIHHAHMMA MLPARVPLPL DLKEGEPIYV  60
NAKQYHAILR RRQYRAKLEA QNKLIKVRKP YMHESRHLHA IKRARGSGGQ FLNTKKLQSK  120
STPTSHGPDM SRSPQLHLSA NISVTDVHQP ENFKDSGSAN SCSDVTSASN SDEIFQQPDF  180
RFYGYPSCHT GEAMPGHAGH ILLSSNSRAN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-2056119366NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445239.11e-150PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X2
SwissprotQ93ZH29e-56NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A0D2ULV81e-155A0A0D2ULV8_GOSRA; Uncharacterized protein
STRINGGorai.009G143800.11e-147(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-54nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]