PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G143800.2
Common NameB456_009G143800, LOC105769266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 296aa    MW: 32502.3 Da    PI: 9.8427
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G143800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.12.2e-31141196258
           CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         ep+YVNaKQy++Il+RRq Rakle+++kl +k rkpy+heSRh hA++R+RgsgG+F
  Gorai.009G143800.2 141 EPIYVNAKQYHAILRRRQYRAKLEAQNKL-IKVRKPYMHESRHLHAIKRARGSGGQF 196
                         8****************************.*************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.2E-35138199IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.263139199IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.8E-26141196IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.0E-23142164IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860144164IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.0E-23173196IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGVLPQHFHN NEQLSFQFQD QDSSSTQSTG QSYPEVASAK DRNLYGQTLT SASSGGNGTH  60
GKLVGNHAKL AYVTGTQDHV FPPSQGYRKP IVHIPHHYAN PYLGSVAATA YGSQAMQIHH  120
AHMMAMLPAR VPLPLDLKEG EPIYVNAKQY HAILRRRQYR AKLEAQNKLI KVRKPYMHES  180
RHLHAIKRAR GSGGQFLNTK KLQSKSTPTS HGPDMSRSPQ LHLSANISVT DVHQPENFKD  240
SGSANSCSDV TSASNSDEIF QQPDFRFYGY PSCHTGEAMP GHAGHILLSS NSRAN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-20141204366NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445237.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012445238.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A0D2QFW90.0A0A0D2QFW9_GOSRA; Uncharacterized protein
STRINGGorai.009G143800.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.14e-57nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]