PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G123600.1
Common NameB456_009G123600, LOC105771252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 152aa    MW: 16953.3 Da    PI: 8.6032
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G123600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.11.9e-4051041100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaC++lrr+C++dC+l+pyfp+++p++fa vh+++Gasnv+kll++lp++ r +a++sl++eA++r++dPvyG+vg+i+ lqqq+++++
  Gorai.009G123600.1   5 RCAACRYLRRRCTQDCILSPYFPSNNPQRFASVHRIYGASNVTKLLQRLPTHLRAEAADSLYFEAQCRLEDPVYGCVGLIFLLQQQIHSAE 95 
                         6****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++l ++++e
  Gorai.009G123600.1  96 SQLIKTQAE 104
                         **9999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.7084105IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-405102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MSSGRCAACR YLRRRCTQDC ILSPYFPSNN PQRFASVHRI YGASNVTKLL QRLPTHLRAE  60
AADSLYFEAQ CRLEDPVYGC VGLIFLLQQQ IHSAESQLIK TQAEIAVMKS QTQHPRTQPF  120
PAISGSNNLL LQQSDNDANL SFSNQVSFGF I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6074015e-77JX607401.1 Gossypium hirsutum clone NBRI_GE47812 microsatellite sequence.
GenBankJX5960925e-77JX596092.1 Gossypium hirsutum clone NBRI_GE32583 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448120.11e-109PREDICTED: LOB domain-containing protein 24-like
SwissprotP594683e-53LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A0D2RZL81e-109A0A0D2RZL8_G
STRINGPOPTR_0012s13910.18e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.14e-44LOB domain-containing protein 24
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]