PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G115000.6
Common NameB456_009G115000, LOC105767978
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 118aa    MW: 13085.7 Da    PI: 10.6754
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G115000.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1071.6e-332278158
           CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                        +ep++VNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+RgsgGrF
  Gorai.009G115000.6 22 EEPVFVNAKQYHGILRRRQSRAKAESENKL-AKSRKPYLHESRHLHALRRARGSGGRF 78
                        69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.4E-362081IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.0392181IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.1E-282378IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.1E-242446IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068602646IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.1E-245578IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MVHLQLMGIQ QAGVPLPSDA VEEPVFVNAK QYHGILRRRQ SRAKAESENK LAKSRKPYLH  60
ESRHLHALRR ARGSGGRFLN SKKNENKQNE AAPSDKSQSN INLNSDKNEL ASTEGNC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-232186166NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4227755e-61AM422775.1 Antirrhinum majus mRNA for YA6 (nf-YA gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443082.13e-81PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443083.13e-81PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443084.13e-81PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443085.13e-81PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_016688766.13e-81PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_016688767.13e-81PREDICTED: nuclear transcription factor Y subunit A-7-like
SwissprotQ84JP14e-51NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A0D2Q4N46e-80A0A0D2Q4N4_GOSRA; Uncharacterized protein
TrEMBLA0A0D2RQ524e-80A0A0D2RQ52_GOSRA; Uncharacterized protein
TrEMBLA0A1U8JEL56e-80A0A1U8JEL5_GOSHI; nuclear transcription factor Y subunit A-7-like
TrEMBLA0A2P5QSQ26e-80A0A2P5QSQ2_GOSBA; Uncharacterized protein
STRINGGorai.009G115000.11e-80(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.21e-53nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]