PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G115000.1
Common NameB456_009G115000, LOC105767978
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 204aa    MW: 22486.8 Da    PI: 8.8657
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G115000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.35.2e-33108164158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         +ep++VNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+RgsgGrF
  Gorai.009G115000.1 108 EEPVFVNAKQYHGILRRRQSRAKAESENKL-AKSRKPYLHESRHLHALRRARGSGGRF 164
                         69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.4E-36106167IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.039107167IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.5E-28109164IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.7E-24110132IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860112132IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.7E-24141164IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MTSSAHDLSD NNEVDEQKKH SEFSDHSSSP VTGLSPSSIT TPNMPYTTPQ HAVAPAAYPY  60
PDPYYRSIFA PYDAQSYPPQ PYGGQPMVHL QLMGIQQAGV PLPSDAVEEP VFVNAKQYHG  120
ILRRRQSRAK AESENKLAKS RKPYLHESRH LHALRRARGS GGRFLNSKKN ENKQNEAAPS  180
DKSQSNINLN SDKNELASTE GNC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-22107172166NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4227751e-62AM422775.1 Antirrhinum majus mRNA for YA6 (nf-YA gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443082.11e-150PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443083.11e-150PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443084.11e-150PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443085.11e-150PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_016688766.11e-150PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_016688767.11e-150PREDICTED: nuclear transcription factor Y subunit A-7-like
SwissprotQ84JP14e-70NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A0D2Q4N41e-148A0A0D2Q4N4_GOSRA; Uncharacterized protein
TrEMBLA0A1U8JEL51e-148A0A1U8JEL5_GOSHI; nuclear transcription factor Y subunit A-7-like
TrEMBLA0A2P5QSQ21e-148A0A2P5QSQ2_GOSBA; Uncharacterized protein
STRINGGorai.009G115000.11e-149(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.22e-54nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]