PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G107900.3
Common NameB456_009G107900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 277aa    MW: 30380.7 Da    PI: 10.6813
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G107900.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.22.6e-19195228134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         C++C +t+Tp+WR+gp g+ktLCnaCG++yr+ +
  Gorai.009G107900.3 195 CTHCEVTETPQWREGPMGPKTLCNACGVRYRSGR 228
                         *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.4E-17189239IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.477193225IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-15194252No hitNo description
CDDcd002021.63E-14194241No hitNo description
Gene3DG3DSA:3.30.50.101.4E-14194226IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440195220IPR000679Zinc finger, GATA-type
PfamPF003203.0E-17195228IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MNFYSLPLTK IPKSSIDAKE SLSLPPFSFS SDPNKKQRTR LQPSSSNQCD GSSQLNQLSS  60
TTSITPHSDC TDVKGSTWFQ TSSPVSVLES SSPCSAANPT PIDPKLSFLV KKRGRSKRRP  120
ASTFNQQFIF SSISSTSSAS RGTNYVVGSE SESENNPTEK PAKKRQKKKK NLTLLSGCNE  180
TKKPPSLQPI VIMKCTHCEV TETPQWREGP MGPKTLCNAC GVRYRSGRLF PEYRPAASPT  240
FVASMHSNSH KKVVEMRKKA KLPLSLSSIP PKMSFR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443598.11e-149PREDICTED: GATA transcription factor 11-like
TrEMBLA0A0D2RY950.0A0A0D2RY95_G
STRINGPGSC0003DMT4000208761e-52(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.26e-37GATA transcription factor 11
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]