PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G083500.1
Common NameB456_009G083500, LOC105770859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 411aa    MW: 45820.6 Da    PI: 8.7635
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G083500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1591.9e-49191451128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         + pGfrF+Ptd el+++yL+kk+eg +  + evi+e++i+++ePwdLp k+v ++++ew+fF+ r +ky++g++++rat++gyWkatgk++
  Gorai.009G083500.1  19 MFPGFRFSPTDVELISYYLTKKLEGYEKCV-EVIPEIEICRYEPWDLPdKSVIKSDNEWFFFCARGRKYPNGSQSRRATEQGYWKATGKER 108
                         579************************777.99***************777777899********************************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +v+s +++++g+k+tLvf++grapkge+t+W+mhey +
  Gorai.009G083500.1 109 NVKS-GSNVIGTKRTLVFHTGRAPKGERTEWIMHEYCM 145
                         ****.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-5510160IPR003441NAC domain
PROSITE profilePS5100552.47319161IPR003441NAC domain
PfamPF023657.9E-2521144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MAGEGVSRET QMSIEASSMF PGFRFSPTDV ELISYYLTKK LEGYEKCVEV IPEIEICRYE  60
PWDLPDKSVI KSDNEWFFFC ARGRKYPNGS QSRRATEQGY WKATGKERNV KSGSNVIGTK  120
RTLVFHTGRA PKGERTEWIM HEYCMNGKSQ DSLVVCRLRK NSEFRLNNTS SRAPRNAPQL  180
SPIRDSNCAT SNGGADQTGT YKGDKAYLKK GTSSYDSHSI EQFDSASESE QKLSNEVGAT  240
DSSTPQKDSD AEEDYFAEIL KDDIIKLDET PLSARPDISP RIASSSDAGQ RRREQPRKEN  300
EPHVAHLQGT ANRRIKLRKP KAADYVVAAK ASTELERGVG EMSIDKLTSP KSGDSPKWLL  360
SLFAPSTANL RFIYATFVIL TLVALFLTVL LGGFQACKKL QIYATLLNNL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-411816016164NO APICAL MERISTEM PROTEIN
1ut4_B1e-411816016164NO APICAL MERISTEM PROTEIN
1ut7_A1e-411816016164NO APICAL MERISTEM PROTEIN
1ut7_B1e-411816016164NO APICAL MERISTEM PROTEIN
3swm_A1e-411816019167NAC domain-containing protein 19
3swm_B1e-411816019167NAC domain-containing protein 19
3swm_C1e-411816019167NAC domain-containing protein 19
3swm_D1e-411816019167NAC domain-containing protein 19
3swp_A1e-411816019167NAC domain-containing protein 19
3swp_B1e-411816019167NAC domain-containing protein 19
3swp_C1e-411816019167NAC domain-containing protein 19
3swp_D1e-411816019167NAC domain-containing protein 19
4dul_A1e-411816016164NAC domain-containing protein 19
4dul_B1e-411816016164NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1311318NRRIKLRK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in plant cell division. {ECO:0000269|PubMed:16803883}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472390.0KC847239.1 Gossypium hirsutum NAC domain protein NAC62 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313909.10.0NAC domain-containing protein 89
RefseqXP_012447666.10.0PREDICTED: NAC domain-containing protein 89
SwissprotQ94F581e-100NAC89_ARATH; NAC domain-containing protein 89
TrEMBLA0A0D2UIG00.0A0A0D2UIG0_GOSRA; Uncharacterized protein
TrEMBLW6JBA90.0W6JBA9_GOSHI; NAC domain protein NAC62
STRINGGorai.009G083500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM104532533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.11e-103NAC domain containing protein 89
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]