PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G078800.1
Common NameB456_009G078800, LOC105768136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 812aa    MW: 89546.3 Da    PI: 7.3631
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G078800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.42.4e-22173274199
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+k+lt sd++ +g ++ p++ ae++      ++++ s++l+ +d++g +W++++i+r++++r++lt+GW+ Fv++++L +gD v+F   +
  Gorai.009G078800.1 173 FCKTLTASDTSIHGGFSAPRRAAEDCfprldYKQTRPSQELVAKDLHGVEWRFRHIFRGQPRRHLLTTGWSVFVSQKNLIAGDAVLFL--R 261
                         99****************************8444556789************************************************..4 PP

                         SSEE..EEEEE-S CS
                  B3  87 rsefelvvkvfrk 99 
                          +++el+++++r+
  Gorai.009G078800.1 262 GEDGELRLGIRRA 274
                         49999*****996 PP

2Auxin_resp113.32.3e-37299380182
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                         +++a+stk vF+v+Y+Pras++eFv++++k+ k+++++++ G Rf+m+fe++d +err+ G+v+g+ d+dp++WpnSkWr++
  Gorai.009G078800.1 299 VSNALSTKRVFQVCYCPRASHAEFVIPFQKYIKSITNPMCTGARFRMKFEMDDLPERRCNGVVTGIGDSDPYKWPNSKWRCV 380
                         5789*****************************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.2E-38164286IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-41165287IPR015300DNA-binding pseudobarrel domain
CDDcd100171.41E-21171273No hitNo description
PROSITE profilePS5086312.323173275IPR003340B3 DNA binding domain
SMARTSM010193.8E-21173275IPR003340B3 DNA binding domain
PfamPF023629.0E-21173274IPR003340B3 DNA binding domain
PfamPF065071.5E-30300380IPR010525Auxin response factor
SuperFamilySSF542774.38E-10672755No hitNo description
PfamPF023091.4E-6672761IPR033389AUX/IAA domain
PROSITE profilePS5174521.308676758IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MEIDLNHAVN EVEKTVLCNG SCEKASACVY CLSSSSSSSS SSSSSSSCSS NSGSPPCSSS  60
IDLELWHACA GPLTSLPKKG NVVVYFPQGH LEQLALAFPF SPLDTFDLPP QIFCKVMNVQ  120
LLANKENDEV YTQVTLLPQP ELGGHNLGSK QLDEVGADEH ADGSPSKPTS HMFCKTLTAS  180
DTSIHGGFSA PRRAAEDCFP RLDYKQTRPS QELVAKDLHG VEWRFRHIFR GQPRRHLLTT  240
GWSVFVSQKN LIAGDAVLFL RGEDGELRLG IRRAVRPRTG LPDSVIAKHN SYPKVLSAVS  300
NALSTKRVFQ VCYCPRASHA EFVIPFQKYI KSITNPMCTG ARFRMKFEMD DLPERRCNGV  360
VTGIGDSDPY KWPNSKWRCV MVRWDDDIAS DHQERVSPWE IDPPVFPPPL SIPSPFRLKK  420
LRTGLQTAAL DTPITGGVGY LDFEESTRSS KVLQGQENVG FISPVYGCGT VNHPLNSEMQ  480
SMAHQSLAST GIGKSNISDF MRAHSSSYTG FAETNRFPKV LQGQEICSLR SLTHKADLNL  540
GVWAKTNHGC NSFNMNQAPN TNCYPEGLRN MYFPYNEFYK AGQEPKMFSY ASKLPRGNVL  600
FNASSIKPGV SVDDIRKPNP PNDHKPMENI PSPGFGKKLR NQQNECYKGN VAGCKLFGFS  660
LTAESPTLNS QNSGKRSCTK VHKQGSLVGR AIDLSRLYGY KDLMTELEHL FGMEGLLNDP  720
DKGWRVLYTD RDNDVMVVGD DPWHEFCDVV SKIHIYTGEE VEKMTVGMGS DETQSCLEEA  780
AVIMEASKSS SVGQPDSSPT VMRGMKISVC F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-117464032354Auxin response factor 1
4ldy_B1e-117464032354Auxin response factor 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6277720.0KJ627772.1 Gossypium hirsutum auxin responsive factor ARF5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443345.10.0PREDICTED: auxin response factor 4 isoform X1
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A0D2TFP70.0A0A0D2TFP7_GOSRA; Auxin response factor
STRINGGorai.009G078800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  3. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  4. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  5. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  6. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  7. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]