PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G049300.1
Common NameB456_009G049300, LOC105771099
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 361aa    MW: 39749.1 Da    PI: 6.5027
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G049300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11e-17248282135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Gorai.009G049300.1 248 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 282
                         99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.1E-7710338IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.519242278IPR000679Zinc finger, GATA-type
SMARTSM004014.2E-17242292IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.5E-14243279IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.19E-15244306No hitNo description
CDDcd002021.66E-14247294No hitNo description
PROSITE patternPS003440248273IPR000679Zinc finger, GATA-type
PfamPF003201.3E-15248282IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEAPEFVPGT TCCSQFTPDK PDHFIVEDLL DFSNDDTILT DQTFDSFSAA AHSTDSSSVT  60
PFDTCNSSSF SASQPNLVAG IASRAFNDGH SSADLYVPCD DLAELEWLSN FVDESFSSDD  120
LQKHQLISGI KIRPDESSET GGFQSVLPNQ INDAIDNGDN NHSNNTNNPI FHPDMSVPAK  180
ARSKRSRAAP CNWASRLLVL SPTTSSSEPD IVVPVQPPPP NHPGKKPVKT ISSKKKEGGV  240
ANSDGRKCLH CATDKTPQWR TGPMGPKTLC NACGVRYKSG RLVPEYRPAA SPTFVLTKHS  300
NSHRKVLELR RQKEMLRAQQ HHQQPFMHHH HQNMVFDVSN GDDYLIHQHV GPDFRQLILE  360
*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447956.10.0PREDICTED: GATA transcription factor 12-like
SwissprotP697811e-95GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A0D2TJP40.0A0A0D2TJP4_G
STRINGPOPTR_0006s25410.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66252644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.14e-82GATA transcription factor 12
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]