PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G025900.1
Common NameB456_009G025900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 532aa    MW: 57247.9 Da    PI: 8.1804
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G025900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR39.61.1e-1268106241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++k+ nCk+s+Clk+YCeCf++g +C+e C+C +C N+ e
  Gorai.009G025900.1  68 KQKHSNCKHSRCLKLYCECFSSGMYCDE-CNCVNCYNNVE 106
                         78999**********************9.********976 PP

2TCR42.11.7e-13151187137
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCk 37 
                         k++kgC+Ck+s Cl+kYCeCf+a+  C e+CkC +Ck
  Gorai.009G025900.1 151 KHSKGCHCKRSGCLRKYCECFQANILCYESCKCMGCK 187
                         589*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.6E-1367107IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.92168191IPR005172CRC domain
PfamPF036389.6E-1070104IPR005172CRC domain
SMARTSM011142.8E-12151190IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.7E-10154187IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MDVASWSPAA ASVNQQQQPQ IKQQVAATIS VAAGQSHPLT TASSSIVKPE SLKAKTRPNE  60
LNDEAPKKQK HSNCKHSRCL KLYCECFSSG MYCDECNCVN CYNNVEYEAV RRDSVGATLK  120
SNLNAFRPKI NSSSHGAKDN KEAGEVLMLG KHSKGCHCKR SGCLRKYCEC FQANILCYES  180
CKCMGCKKFK GSEERQALFH GDYANNMAYI QQAANATTTG AIGSSGYASA PVSKKRKSQE  240
FLLGSTAKDP SVHSLGHLQQ TNLVRASIPS SSLSSMSVSC AGTAVGPSKL SYRSLLADII  300
QKQDLKELCS VLVVLSREAA KILADQRSLI EGAEDHSEIS FASSTQDRLE SQKDFIAEKT  360
RADNCSSANQ AVKSGPENSC TDVADMPEGS LMSPGTLALM CDEQDTTFTA AVSQLPCGKG  420
MIEIDAEHER VVLTKFRDCL NRLITFGEIK GMCCSTLARM EIGSQRCPLS HRAETGNQQG  480
FVNYGVPKTF FSPTVRTSKT AAVVATADND LPTVPPFPGN GDAKSKPAKQ M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-28602002132Protein lin-54 homolog
5fd3_B7e-28602002132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016689960.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD11e-155TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0D2RSR30.0A0A0D2RSR3_GOSRA; Uncharacterized protein
STRINGGorai.009G025900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-137Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]