PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G262400.1
Common NameB456_008G262400, LOC105765386
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 793aa    MW: 85776.3 Da    PI: 5.6655
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G262400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.93.7e-3093177187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+laL+++r++m+ ++r++  k+plWe+vs+k++e g++rs+k+C+ek+en++k+yk++ke++ +r++++s  +++f+qlea
  Gorai.008G262400.1  93 RWPRQETLALLKIRSDMDATFRDATVKGPLWEDVSRKLAELGYKRSAKKCREKFENVHKYYKRTKETRAGRQDGKS--YKFFSQLEA 177
                         8*********************************************************************866665..*******85 PP

2trihelix109.91.6e-34532617187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k evlaLi++r+ +e+r++++  k+plWee+s+ m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+ +tcpyf+ql+a
  Gorai.008G262400.1 532 RWPKTEVLALINLRSGLESRYQEAGPKGPLWEEISAGMSRLGYKRSAKRCKEKWENINKYFKKVKESNKKR-PEDAKTCPYFHQLDA 617
                         8*********************************************************************8.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.004890152IPR001005SANT/Myb domain
PfamPF138377.5E-2192178No hitNo description
PROSITE profilePS500906.66792150IPR017877Myb-like domain
CDDcd122033.01E-2892157No hitNo description
SMARTSM007170.035529591IPR001005SANT/Myb domain
PfamPF138371.5E-23531618No hitNo description
PROSITE profilePS500906.76531589IPR017877Myb-like domain
CDDcd122035.26E-32531596No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MQQEGGGGGG GGGGGGQQSQ YGEMTTGPPT TGAVSEASEQ LVEAASPISS RPPAGNLDEF  60
MRLASVGGGD ELGLGDRHGS GGGGGAGVAS GNRWPRQETL ALLKIRSDMD ATFRDATVKG  120
PLWEDVSRKL AELGYKRSAK KCREKFENVH KYYKRTKETR AGRQDGKSYK FFSQLEALQT  180
TSGAAPANVS IPVIPATVAV TATSLDVAPV SVGIPMPISS AARIVPPTTA VPMSSSSFLA  240
MPGSALAPVP VAVPEPATAP APAPPAATTA APFGISFSSN SSTFSQGFDD DEEDEDEVGV  300
GGEPSSMAGT SRKRKRSSSR GGGGSSTRRM MEFFEGLMKQ VMQKQEAMQQ RFLEAMEKRE  360
QDRTIREEAW KRQEMARLTR EHELMAQERA IAASRDAAIV SFLQKITGQT IQLPTTATVI  420
VPAAPPPPPP TQPTVSVVPP EVPIAPPSHQ TPTLPQQKQQ EQQQTHISHH QPPPPQQQPQ  480
VVQQQQQLQH MELVRHQQQP ITTEIVMAIP EQQVPPQEIG GSGSLAEPAS SRWPKTEVLA  540
LINLRSGLES RYQEAGPKGP LWEEISAGMS RLGYKRSAKR CKEKWENINK YFKKVKESNK  600
KRPEDAKTCP YFHQLDALYR KKILGGGTSS GSFSDHNRPD EETSRQHHDP TLSTAAPQPS  660
QNESGATADV VTSKEGLPSH PFGEGYGGAA KKPGSTVREL MEEQREGLHH QQHHHRGQSL  720
LVDGYGRIDE PDSDIMDQEV DEDDDEEDND DDDDEELEEE RKMGYKIEFQ RQNSNTPNGG  780
GNGAPSFFTM VQ*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439901.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X1
SwissprotQ391174e-71TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0D2UA280.0A0A0D2UA28_GOSRA; Uncharacterized protein
STRINGGorai.008G262400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62262746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.11e-56GT-2-like 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]