PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G261400.3
Common NameB456_008G261400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 722aa    MW: 79886.9 Da    PI: 4.7548
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G261400.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.4e-5491351127
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lp GfrF+Ptdeel+++yL+ k++g++ e+ evi+e+d++k+ePwdLp  + +k+++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd
  Gorai.008G261400.3   9 LPLGFRFRPTDEELINHYLRLKINGRHSEV-EVIPEIDVCKWEPWDLPglSVIKSDDLEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKD 98 
                         699************************999.99***************6447778888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                         ++++s k++l+g+kktLvfykgrapkge+t+W+mheyr
  Gorai.008G261400.3  99 RTIKS-KKSLIGMKKTLVFYKGRAPKGERTNWIMHEYR 135
                         *****.899****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-625159IPR003441NAC domain
PROSITE profilePS5100557.8389159IPR003441NAC domain
PfamPF023651.0E-2710135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MEVLTMGTLP LGFRFRPTDE ELINHYLRLK INGRHSEVEV IPEIDVCKWE PWDLPGLSVI  60
KSDDLEWFFF CPRDRKYPNG HRSNRATDKG YWKATGKDRT IKSKKSLIGM KKTLVFYKGR  120
APKGERTNWI MHEYRPTTKE LDGTAPGQSA FVLCRLFHKV EGRNDIVKYD EVEQTGYSPA  180
MIKSSPDDTS SDLLQDTVSS DTQAQKPDNL MQNDQITGDT SSCNSHMTSN ADYHATEETM  240
MEKYPLPGSN SNLYEPNYGE IDSKVFSPLM NSQLFEDLPF FVDSPYANDF GHDQNGFHFQ  300
DGTSEQDVSF AFLDDILSNH YDSCEESNTQ KNLVDGTEMP LFGDSFISKT PPPEISYLKE  360
NGRPADTDTE MPQLQFGTEV GARRWLGGPI DNNQSLQMQT SFQPTHTQPA LYNQEYRTRN  420
IGGLGNYSVG QVTFTDSAMG NINNLQQLTS LKNYVNSGGD LGGGIGMKTG TCQPLKQSNS  480
ENFGTLGTGI KIRTRGSQQQ PNSDIVNQGT APRRIRLMKL SSGPMKGSVG CVDDEKMMST  540
CLVEEEEVQS ALTEVTEAEA AGQTSSSDES EKNIVNQAIA PRRIRLQLST GPMNGSAGCV  600
DGGNMTSPGL GKEEVQSALT EATEDEATGQ ISSSCETSSS DESEVENRFL KFEGSRDADE  660
SYSKPRLRVK QVDEQHSCSQ KGPSLHLKAA PALHRPNSLL VPGIAIFTIT LLFALFMGIW  720
L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-46915915168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439882.10.0PREDICTED: protein NTM1-like 9 isoform X5
TrEMBLA0A0D2TCZ10.0A0A0D2TCZ1_GOSRA; Uncharacterized protein
STRINGGorai.008G261400.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.11e-139NAC 014
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]