PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G227800.1
Common NameB456_008G227800, LOC105765019
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 327aa    MW: 37200.4 Da    PI: 5.7473
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G227800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.7e-5361331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeel+ +yLk+k+eg ++el evi+ +d+yk++PwdLp k  + +++ ew+fF++rd+ky++g+r+nratk+gyWkatgkd
  Gorai.008G227800.1   6 LPPGFRFHPTDEELIGYYLKRKTEGLEIEL-EVIPVIDLYKFDPWDLPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATKAGYWKATGKD 95 
                         79****************************.99**************95334445667********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v++ ++ ++g +ktLvfy+grap g +tdW+mheyrl
  Gorai.008G227800.1  96 RKVVC-QSDVTGYRKTLVFYRGRAPLGDRTDWIMHEYRL 133
                         *****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-604155IPR003441NAC domain
PROSITE profilePS5100558.726155IPR003441NAC domain
PfamPF023656.4E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGGASLPPGF RFHPTDEELI GYYLKRKTEG LEIELEVIPV IDLYKFDPWD LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATKAGYWK ATGKDRKVVC QSDVTGYRKT LVFYRGRAPL  120
GDRTDWIMHE YRLSDEPSQG STNQGAFALC RVVKRNEPKA SDARGEPKAT KVGSSSTNVI  180
LPVPRTCNSG NISCQASYPN RESHYTSSEV MRVPPFEPVS VNSDPRGVWV SPDLILDSSK  240
DYPQTCESTA QYFPQYEFPS SLTPWQQYEQ IDFSPSSSYS NFGEIEHDDL SRIGYMSPYS  300
GHANYMDFYG NEGNDQTGLF NYMNPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-54515616166NO APICAL MERISTEM PROTEIN
1ut4_B6e-54515616166NO APICAL MERISTEM PROTEIN
1ut7_A6e-54515616166NO APICAL MERISTEM PROTEIN
1ut7_B6e-54515616166NO APICAL MERISTEM PROTEIN
3swm_A7e-54515619169NAC domain-containing protein 19
3swm_B7e-54515619169NAC domain-containing protein 19
3swm_C7e-54515619169NAC domain-containing protein 19
3swm_D7e-54515619169NAC domain-containing protein 19
3swp_A7e-54515619169NAC domain-containing protein 19
3swp_B7e-54515619169NAC domain-containing protein 19
3swp_C7e-54515619169NAC domain-containing protein 19
3swp_D7e-54515619169NAC domain-containing protein 19
4dul_A6e-54515616166NAC domain-containing protein 19
4dul_B6e-54515616166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472320.0KC847232.1 Gossypium hirsutum NAC domain protein NAC55 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314447.10.0NAC domain-containing protein 86
RefseqXP_012439347.10.0PREDICTED: NAC domain-containing protein 86-like
SwissprotO496971e-106NAC71_ARATH; NAC domain-containing protein 71
TrEMBLA0A0D2TAZ50.0A0A0D2TAZ5_GOSRA; Uncharacterized protein
TrEMBLW6J8Y80.0W6J8Y8_GOSHI; NAC domain protein NAC55
STRINGGorai.008G227800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21512777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-108NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  4. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]