PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G197500.1
Common NameB456_008G197500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 184aa    MW: 21506.3 Da    PI: 8.2046
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G197500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM76.85e-24151461128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev..ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknra...tksgyWkat 86 
                         lp+GfrF Ptd e v++yL +kv  ++++ + +  i+ +++y+  P++   ++ ++e+ew+fF+  d +  + ++k       + g+W++ 
  Gorai.008G197500.1  15 LPVGFRFLPTDVEFVTHYLINKVIYNPFSSFIFqeINATELYTKSPKNSV-QFCNGEREWFFFIYMDMNIDNMHNKAIEkggDELGFWQSM 104
                         79*************************776543349999********985.566789*********99988755444432224589***** PP

                 NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         g  k v++++g++  +k t+ +++g+ ++ +kt+W ++e+rl
  Gorai.008G197500.1 105 GDRKCVKDTNGNTLATKITFLYFSGSPSHRKKTHWRIDEFRL 146
                         ****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-2614150IPR003441NAC domain
PROSITE profilePS5100525.80815177IPR003441NAC domain
PfamPF023655.6E-1416146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MEDQVAGNED YGDKLPVGFR FLPTDVEFVT HYLINKVIYN PFSSFIFQEI NATELYTKSP  60
KNSVQFCNGE REWFFFIYMD MNIDNMHNKA IEKGGDELGF WQSMGDRKCV KDTNGNTLAT  120
KITFLYFSGS PSHRKKTHWR IDEFRLPIQF YTLHNSKKIE GNNFTKEKWA AGRLTRGRDY  180
TSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022715890.15e-66protein CUP-SHAPED COTYLEDON 2-like
TrEMBLA0A0D2U6991e-135A0A0D2U699_GOSRA; Uncharacterized protein
STRINGGorai.008G197500.11e-136(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2188055
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.12e-17NAC domain containing protein 94
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]