PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G194400.3
Common NameB456_008G194400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 303aa    MW: 34072.8 Da    PI: 9.3091
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G194400.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1141.6e-3588650129
                 NAM  50 kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         k+k +ekewyfF+ rd+ky+tg r+nrat+sgyWkatgkdke+++ +++lvg+kktLvfykgrapkgekt+Wvmheyrle
  Gorai.008G194400.3   8 KAKMGEKEWYFFCVRDRKYPTGLRTNRATDSGYWKATGKDKEIYR-GKSLVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 86 
                         4567899**************************************.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.9141110IPR003441NAC domain
SuperFamilySSF1019415.23E-417110IPR003441NAC domain
PfamPF023654.3E-171485IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MCCLVAGKAK MGEKEWYFFC VRDRKYPTGL RTNRATDSGY WKATGKDKEI YRGKSLVGMK  60
KTLVFYKGRA PKGEKTNWVM HEYRLEGKYS VHNLPKTAKN EWVICRVFQK SSGGKKTHIS  120
GLVNMGSFGN ELGPSVLPPL MDSSSSFNAK KNPVSESVYV PCFSNPVDVQ RIQLDTIDHF  180
PENPLLLPVS SNPTNIFPRF QAPNPFFSAQ PVTFPPNLHL PGSVLMQDQS ILRDLLENHG  240
SNMKSERETM VSVSQETGLT TDINNEISSV VSNLEIRKRP FNDQQHPSAS TGPLDFDCFW  300
HY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-34411664174NAC domain-containing protein 19
3swm_B4e-34411664174NAC domain-containing protein 19
3swm_C4e-34411664174NAC domain-containing protein 19
3swm_D4e-34411664174NAC domain-containing protein 19
3swp_A4e-34411664174NAC domain-containing protein 19
3swp_B4e-34411664174NAC domain-containing protein 19
3swp_C4e-34411664174NAC domain-containing protein 19
3swp_D4e-34411664174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.10970.0seedling
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO487455790.0
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9141420.0JQ914142.1 Gossypium hirsutum NAC domain protein 11 (NAC11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438781.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-113NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D2T8X50.0A0A0D2T8X5_GOSRA; Uncharacterized protein
STRINGGorai.008G194400.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-115NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]