PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G194400.1
Common NameB456_008G194400, LOC105764664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 359aa    MW: 40651.1 Da    PI: 8.0062
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G194400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.31.2e-56161421129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL kkv + ++++ ++i evd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat+sgyWkatgkdke
  Gorai.008G194400.1  16 LPPGFRFHPTDEELISHYLYKKVLDVNFSA-KAIGEVDLNKSEPWELPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATDSGYWKATGKDKE 105
                         79**************************99.88***************888999************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++ +++lvg+kktLvfykgrapkgekt+Wvmheyrle
  Gorai.008G194400.1 106 IYR-GKSLVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 142
                         ***.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-6512166IPR003441NAC domain
PROSITE profilePS5100560.23316166IPR003441NAC domain
PfamPF023651.4E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MANIGAIDQE NDQMDLPPGF RFHPTDEELI SHYLYKKVLD VNFSAKAIGE VDLNKSEPWE  60
LPWKAKMGEK EWYFFCVRDR KYPTGLRTNR ATDSGYWKAT GKDKEIYRGK SLVGMKKTLV  120
FYKGRAPKGE KTNWVMHEYR LEGKYSVHNL PKTAKNEWVI CRVFQKSSGG KKTHISGLVN  180
MGSFGNELGP SVLPPLMDSS SSFNAKKNPV SESVYVPCFS NPVDVQRIQL DTIDHFPENP  240
LLLPVSSNPT NIFPRFQAPN PFFSAQPVTF PPNLHLPGSV LMQDQSILRD LLENHGSNMK  300
SERETMVSVS QETGLTTDIN NEISSVVSNL EIRKRPFNDQ QHPSASTGPL DFDCFWHY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-5691727171NO APICAL MERISTEM PROTEIN
1ut4_B1e-5691727171NO APICAL MERISTEM PROTEIN
1ut7_A1e-5691727171NO APICAL MERISTEM PROTEIN
1ut7_B1e-5691727171NO APICAL MERISTEM PROTEIN
3swm_A1e-56917210174NAC domain-containing protein 19
3swm_B1e-56917210174NAC domain-containing protein 19
3swm_C1e-56917210174NAC domain-containing protein 19
3swm_D1e-56917210174NAC domain-containing protein 19
3swp_A1e-56917210174NAC domain-containing protein 19
3swp_B1e-56917210174NAC domain-containing protein 19
3swp_C1e-56917210174NAC domain-containing protein 19
3swp_D1e-56917210174NAC domain-containing protein 19
4dul_A1e-5691727171NAC domain-containing protein 19
4dul_B1e-5691727171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.10970.0seedling
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO487455790.0
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9141420.0JQ914142.1 Gossypium hirsutum NAC domain protein 11 (NAC11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438781.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-154NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D2U6150.0A0A0D2U615_GOSRA; Uncharacterized protein
STRINGGorai.008G194400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-156NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]