PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G194100.1
Common NameB456_008G194100, LOC105764655
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 374aa    MW: 42147.7 Da    PI: 6.9592
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G194100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.67.6e-24953145
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        kr e++snrqvt+skRr+gilKKA+ELS+LCd+ + +++fs+tgk
  Gorai.008G194100.1  9 KRLESYSNRQVTYSKRRTGILKKAKELSILCDIHIILLMFSPTGK 53
                        689****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-30160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.077161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-26295IPR002100Transcription factor, MADS-box
CDDcd002661.70E-26282No hitNo description
PRINTSPR004041.5E-18323IPR002100Transcription factor, MADS-box
PfamPF003193.6E-201156IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MGRVKLKIKR LESYSNRQVT YSKRRTGILK KAKELSILCD IHIILLMFSP TGKPTLFHGE  60
RSTIEEVIAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD LNIQDFLGAT QSVEEMTNEV  120
SMLQARLSEV HKRLSYWNNP DKIDNLEHLR QMENSLRESI ERIRIHKENY GKHHLLPLES  180
TSQFQNAMPL PVMIGGVQEA QPVTWLPNND NQQMLLHNES NFLPNLDTEC ATDGSLAGYS  240
GFFVPGKQTD IGNSVQVDNT IQESNVLNEL GNNAFLNSQL GKQYLYPQFS ASNLQDDEKL  300
KSEMVGNLQG DPGVYQVITD FEAPRPMSNG GHQAWISSSG PCGIAMFDGN SYHQQTKSTF  360
MNQTPPSGQC HNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-14192190MEF2 CHIMERA
6byy_B2e-14192190MEF2 CHIMERA
6byy_C2e-14192190MEF2 CHIMERA
6byy_D2e-14192190MEF2 CHIMERA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438772.10.0PREDICTED: MADS-box protein defh21-like isoform X3
SwissprotQ7X9I01e-110AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A0D2RIC30.0A0A0D2RIC3_GOSRA; Uncharacterized protein
STRINGGorai.008G194100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-113AGAMOUS-like 65
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]