PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G179900.2
Common NameB456_008G179900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 210aa    MW: 24386.9 Da    PI: 10.0674
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G179900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1775.2e-55111361128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yLk+++++k++++ ++i+evdiyk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nrat sgyWkatg+dk+
  Gorai.008G179900.2  11 LPPGFRFHPTDEELIMFYLKNQAKSKPCPV-SIIPEVDIYKFDPWQLPDKAEFGENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKA 100
                         79****************************.89***************99999************************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s +++ vg+kk Lvfy+gr pkg+kt+W+mheyrl
  Gorai.008G179900.2 101 IHS-GSKYVGVKKALVFYNGRPPKGVKTNWIMHEYRL 136
                         ***.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-678163IPR003441NAC domain
PROSITE profilePS5100561.15111163IPR003441NAC domain
PfamPF023651.2E-2712136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MERNTSSKSD LPPGFRFHPT DEELIMFYLK NQAKSKPCPV SIIPEVDIYK FDPWQLPDKA  60
EFGENEWYFF SPRDRKYPNG VRPNRATVSG YWKATGTDKA IHSGSKYVGV KKALVFYNGR  120
PPKGVKTNWI MHEYRLSDSH KQIKKHNGSM RLDDWVLCRI YKKKNSAEKI MDHKVEESNT  180
QIDRGLKMLR SYSLETYLTI TVPSQGIFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-7421698171NO APICAL MERISTEM PROTEIN
1ut4_B2e-7421698171NO APICAL MERISTEM PROTEIN
1ut7_A2e-7421698171NO APICAL MERISTEM PROTEIN
1ut7_B2e-7421698171NO APICAL MERISTEM PROTEIN
3swm_A2e-74216911174NAC domain-containing protein 19
3swm_B2e-74216911174NAC domain-containing protein 19
3swm_C2e-74216911174NAC domain-containing protein 19
3swm_D2e-74216911174NAC domain-containing protein 19
3swp_A2e-74216911174NAC domain-containing protein 19
3swp_B2e-74216911174NAC domain-containing protein 19
3swp_C2e-74216911174NAC domain-containing protein 19
3swp_D2e-74216911174NAC domain-containing protein 19
4dul_A2e-7421698171NAC domain-containing protein 19
4dul_B2e-7421698171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438548.11e-137PREDICTED: NAC transcription factor 29-like
SwissprotK4BWV21e-104NAP1_SOLLC; NAC domain-containing protein 1
TrEMBLA0A0D2T8141e-155A0A0D2T814_GOSRA; Uncharacterized protein
STRINGGorai.008G179900.11e-137(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-105NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]