PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G163200.4
Common NameB456_008G163200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 226aa    MW: 26511.2 Da    PI: 7.7755
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G163200.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix88.95.5e-2872153286
            trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         W ++e++ Li++rrem+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k+++++     s +++y++++e
  Gorai.008G163200.4  72 WVQDETRSLIAFRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGS---GSAKMSYYKEIE 153
                         ********************************************************************84...556899***998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-562133IPR009057Homeodomain-like
PROSITE profilePS500908.40964128IPR017877Myb-like domain
SMARTSM007171.8E-468130IPR001005SANT/Myb domain
CDDcd122034.40E-2970135No hitNo description
PfamPF138371.0E-2171155No hitNo description
SuperFamilySSF466897.65E-571132IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MYLSEKPRSI DLYKEEGPAT ARDMIIDVTT NGDLPPHHHH HHPPPHQQQM ILGESSCEDP  60
EVKAPKKRAE TWVQDETRSL IAFRREMDGL FNTSKSNKHL WEQISAKMRE KGFDRSPTMC  120
TDKWRNLLKE FKKAKHQDRG SGSAKMSYYK EIEEILRERT KNAYKSPTPP PKVDSYMHFA  180
DKGFEDAGMS FGPVEGYYFL FQFEIALFWF FFFYLFGFLS FIFFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A4e-5466151186DNA binding protein GT-1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438312.11e-145PREDICTED: trihelix transcription factor GT-1-like isoform X2
SwissprotQ9FX538e-86TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0D2PVW51e-168A0A0D2PVW5_GOSRA; Uncharacterized protein
STRINGGorai.008G163200.11e-143(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.31e-91Trihelix family protein
Publications ? help Back to Top
  1. Le Gourrierec J,Li YF,Zhou DX
    Transcriptional activation by Arabidopsis GT-1 may be through interaction with TFIIA-TBP-TATA complex.
    Plant J., 1999. 18(6): p. 663-8
    [PMID:10417717]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]