PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G147800.1
Common NameB456_008G147800, LOC105764141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TCP
Protein Properties Length: 244aa    MW: 25363.6 Da    PI: 10.6333
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G147800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP123.42.5e-3828117291
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaa 91 
                         a kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++ + s+  ++ns+s ++ 
  Gorai.008G147800.1  28 AIKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTMSVSVRGGANSTSLSST 117
                         689******************************************************************888333333333322222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.5E-3334121IPR005333Transcription factor, TCP
PROSITE profilePS5136928.2093488IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MSNSEGGANN GAIMDPQRQQ ATVNGSLAIK KPPSKDRHSK VDGRGRRIRM PIICAARVFQ  60
LTRELGHKSD GQTIEWLLRQ AEPSIIAATG TGTTPASFST MSVSVRGGAN STSLSSTTSS  120
PSLDHKPLLG PTPFILGKRV RSDDDNPGKY DTGGVMVGPG VVGPAGGFWA LPGRTDFGQL  180
WSFPPPAEMA AHQPAAALFV QQQQAMGEAS AARVGNYLPG HLNLLASLSG APGSSGRRGE  240
DPR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438086.11e-177PREDICTED: transcription factor TCP7-like
SwissprotQ9FMX23e-93TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A0D2U2Q91e-175A0A0D2U2Q9_GOSRA; Uncharacterized protein
STRINGGorai.008G147800.11e-176(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.14e-67TCP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]