PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G130300.2
Common NameB456_008G130300, LOC105763960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 412aa    MW: 46789.3 Da    PI: 6.8324
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G130300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.34.3e-51431711128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi+evd++k+ePwd+++++k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+
  Gorai.008G130300.2  43 VPPGFRFHPTEEELLQYYLRKKVSYEKIDL-DVIREVDLNKLEPWDIQERCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGR 132
                         69****************************.9***************964444122455******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk ++s + + +g++ktLvfykgrap+g+k+ W+mheyrl
  Gorai.008G130300.2 133 DKVIYS-NCRRIGMRKTLVFYKGRAPHGQKSYWIMHEYRL 171
                         ******.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-5738201IPR003441NAC domain
PROSITE profilePS5100555.49843201IPR003441NAC domain
PfamPF023655.6E-2744171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MQISFGIYHH LLFLSQSSST YIVSIFVKMP ENMNISVNGQ SQVPPGFRFH PTEEELLQYY  60
LRKKVSYEKI DLDVIREVDL NKLEPWDIQE RCKIGTTPQN DWYFFSHKDK KYPTGTRTNR  120
ATAAGFWKAT GRDKVIYSNC RRIGMRKTLV FYKGRAPHGQ KSYWIMHEYR LDDNIVETNV  180
SNGMMEGTQE EGWVVCRIFK KKNHHKTLEN PISTSLSEKT RNLHMFNTCS EGALEHILEY  240
MGRSCKEDNE ANNNNTRFVM SMELAINNNG YYDSFTKLPS LDSPNSASSY QPIMTENEGS  300
IINSVSGGDF NSVYNNDSGL TNWAALDRLV ASHLNGQTET SRQLACFNDQ QMAYCNNTNS  360
TDHQDLELPA VRSTSPPSSS SIDIWTSFTT RSSSLSSSVI DPLCHVVNAS V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-494020314167NO APICAL MERISTEM PROTEIN
1ut4_B8e-494020314167NO APICAL MERISTEM PROTEIN
1ut7_A8e-494020314167NO APICAL MERISTEM PROTEIN
1ut7_B8e-494020314167NO APICAL MERISTEM PROTEIN
3swm_A1e-484020317170NAC domain-containing protein 19
3swm_B1e-484020317170NAC domain-containing protein 19
3swm_C1e-484020317170NAC domain-containing protein 19
3swm_D1e-484020317170NAC domain-containing protein 19
3swp_A1e-484020317170NAC domain-containing protein 19
3swp_B1e-484020317170NAC domain-containing protein 19
3swp_C1e-484020317170NAC domain-containing protein 19
3swp_D1e-484020317170NAC domain-containing protein 19
4dul_A8e-494020314167NAC domain-containing protein 19
4dul_B8e-494020314167NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in various aboveground tissues undergoing thickening of the lignified secondary wall such as anthers, filaments of stamens, the base of carpels, styles, the boundaries between siliques and pedicels, the midrib of leaf veins, and inflorescence stems, specifically in interfascicular fibers (sclerenchyma), cells differentiating into vascular vessels, and xylary fibers (secondary xylem). {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472210.0KC847221.1 Gossypium hirsutum NAC domain protein NAC44 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437819.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-132NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0D2SZR40.0A0A0D2SZR4_GOSRA; Uncharacterized protein
STRINGGorai.008G130300.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-122NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  4. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  5. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  6. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  7. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  8. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]