PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G085200.1
Common NameB456_008G085200, LOC105763473
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 171aa    MW: 19824.5 Da    PI: 10.227
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G085200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.94.6e-1361119563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         ++ rr+++NRe+ArrsR RK++ +e+L++ v +L  eN++L ++l  l  ++ ++++++
  Gorai.008G085200.1  61 RKRRRMMSNRESARRSRMRKQKHLENLRNLVNQLRIENRELTSRLRFLLYHCHRVRTDN 119
                         6789*****************************************99988888777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-1257121IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.78359122IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.53E-1061111No hitNo description
PfamPF001703.8E-1061118IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-961134No hitNo description
CDDcd147022.07E-1762113No hitNo description
PROSITE patternPS0003606479IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MSSTVPTMES LECDWDCSQL FSTIQSVGPA GSGSASSEPN QTHSNSGLDE SNLKLSIIEE  60
RKRRRMMSNR ESARRSRMRK QKHLENLRNL VNQLRIENRE LTSRLRFLLY HCHRVRTDNN  120
SLRSEYTVLR QKLSDMQQIL LFKQLQQFSS TWPYNNVPVM SEQTPPPLII *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16064RKRRR
26081RKRRRMMSNRESARRSRMRKQK
37380RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437167.11e-123PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0D2PQZ51e-122A0A0D2PQZ5_G
STRINGVIT_00s0541g00020.t012e-52(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.19e-28basic leucine-zipper 5
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]