PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G073400.2
Common NameB456_008G073400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 300aa    MW: 33295.7 Da    PI: 6.7868
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G073400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.42.2e-4271061100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp ++p+kf+nvhk++Gasnv kll++l++++re+a++sl+yeAear++dPvyG+vg+i+ lq++l+q++
  Gorai.008G073400.2   7 PCAACKFLRRKCTQECVFAPYFPPDHPQKFQNVHKVYGASNVAKLLNELNPSQREEAVTSLAYEAEARLQDPVYGCVGLISILQHRLKQMQ 97 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++l  +k+e
  Gorai.008G073400.2  98 HDLGNAKKE 106
                         **9988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6256107IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-427103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DHPQKFQNVH KVYGASNVAK LLNELNPSQR  60
EEAVTSLAYE AEARLQDPVY GCVGLISILQ HRLKQMQHDL GNAKKELSTY IGPQALLPIL  120
QPPLFFPQQH LGNPSSMMQH NMMPMMGIPT AASLSHGGQL VIREPQQQQQ QFFEPQQQMA  180
AVVAAREQQD FLGGYELQQL HHQQQPDMLR FNNSGFEGAG SVTATGFNQI TPVAAMSPSL  240
ALGCFDNLYQ IQPQEQDHPH HHSHGTLPFQ SQLLLQPLQA QPQVHLRSES EEGRSTGPC*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436996.10.0PREDICTED: LOB domain-containing protein 36
RefseqXP_012436997.10.0PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ32e-84LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0D2SWM30.0A0A0D2SWM3_G
STRINGPOPTR_0007s11460.11e-107(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-64ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]